DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Car3

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_031632.2 Gene:Car3 / 12350 MGIID:88270 Length:260 Species:Mus musculus


Alignment Length:234 Identity:57/234 - (24%)
Similarity:90/234 - (38%) Gaps:23/234 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNF-MPQLSGAELLGRYQ 137
            |||.:...::.......|  |:...|...|..:.|||.|  .|:...:.: ...|.|..|.|.|:
Mouse    29 SPIELHTKDIKHDPSLQP--WSASYDPGSAKTILNNGKT--CRVVFDDTYDRSMLRGGPLSGPYR 89

  Fly   138 FVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLNNNFEYL-------TLSYLFALSHVKN 192
            ..:....|||..   |||::....:..||..:|...:.|...|.|       .:.....:...|.
Mouse    90 LRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKG 154

  Fly   193 EHLKQVTDHLKWISQPGSSIELPPFHLE-SLLQPFGSGYFSYEGTYDNGDVVLPTTWLINRKISV 256
            | .:.:.|.|..|...|.  |.|..|.: |.|.|....|::|.|::..........||:.::...
Mouse   155 E-FQILLDALDKIKTKGK--EAPFTHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMT 216

  Fly   257 VDSRQLSEFEALYGRNGNRN----CKNGREKQPLGNRNV 291
            |.|.|:::..:|:....|..    ..|.|..||:..|.|
Mouse   217 VSSDQMAKLRSLFSSAENEPPVPLVGNWRPPQPVKGRVV 255

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 57/234 (24%)
Car3NP_031632.2 alpha_CA_I_II_III_XIII 1..259 CDD:239393 57/234 (24%)
Involved in proton transfer. /evidence=ECO:0000250 64..67 1/4 (25%)