DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Car11

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_006540651.1 Gene:Car11 / 12348 MGIID:1336193 Length:344 Species:Mus musculus


Alignment Length:275 Identity:68/275 - (24%)
Similarity:108/275 - (39%) Gaps:66/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FQDVVNAVGNRRLEMKLAKQPSPITIPESNMIKRQLKMPLHWTYYEDLPMAT-------VLENNG 110
            |..:|||..:.   ..:.|:.||:.:        :||..|:..:...|.::|       .|.|.|
Mouse    51 FWGLVNAAWSL---CAVGKRQSPVDV--------ELKRVLYDPFLPPLRLSTGGEKLRGTLYNTG 104

  Fly   111 NTVIMRIYTANNFMP------QLSGAELLGRYQFVEAIFKWGS---LKSEHSIGKHNFCLELQAL 166
            ..|        :|:|      .:||..||..::..|....:|:   ..|||.|....|..|:|.:
Mouse   105 RHV--------SFLPASRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHEGFSAEVQLI 161

  Fly   167 HRCAQLNNNFEYLT--------LSYLFALSHVKNEHLKQV--TDHLKWISQPGSSIELPPFHLES 221
            |...:|..|....:        ||....::...|..|.::  .|.:..||....:..|....|| 
Mouse   162 HFNQELYGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLE- 225

  Fly   222 LLQPFGSGYFSYEGTYDNGDVVLPTTW-LINRKISVV-----DSRQLSE------FEALYGRNGN 274
            ||.|...|:.:|:|:..........|| ||:|.:::.     ..|.||:      |::|.|    
Mouse   226 LLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSG---- 286

  Fly   275 RNCKNGREKQPLGNR 289
                |||..|||.:|
Mouse   287 ----NGRPLQPLAHR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 64/259 (25%)
Car11XP_006540651.1 alpha_CARP_X_XI_like 48..304 CDD:239395 68/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.