DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and LOC100496280

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002940642.4 Gene:LOC100496280 / 100496280 -ID:- Length:313 Species:Xenopus tropicalis


Alignment Length:240 Identity:58/240 - (24%)
Similarity:94/240 - (39%) Gaps:34/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAELLGRYQF 138
            |||.|.::::..........:|.|.|.....:|.|.|:||.:::.:.    ..|||..|...|..
 Frog    45 SPINIVDASVQYNASLGTFTFTNYGDSSKLVLLNNPGHTVEVQLASG----VTLSGGGLPSTYSA 105

  Fly   139 VEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLN--------NNFEYLTLSYLFALSHVKN 192
            |...|.||:..   |||.:|...|.:|:..:|....:|        |....|.   .|......:
 Frog   106 VAFHFHWGNTSQNGSEHQLGGRQFPMEMHIVHTKNGMNLTAAKQDPNGIAVLG---FFIDVGTSS 167

  Fly   193 EHLKQVTDHLKWISQPGSSIEL-PPFHLESLLQPFG-SGYFSYEGTYDNGDVVLPT-----TWLI 250
            ..|..:...|..:|..|::|.| ..|.::|:|.... :.|:.|.|:     :..||     .|.:
 Frog   168 SKLPTLASLLVNVSNAGTNITLNGSFSIDSILGAVDRTSYYRYLGS-----LTTPTCDEAVVWTV 227

  Fly   251 NRKISVVDSRQLSEFEA---LYGRNGNRNCKNG-REKQPLGNRNV 291
            .|...:|.:..:..|.:   |......:|..|. |..|.|.:|.|
 Frog   228 FRNPILVPASVIQNFSSNIYLNSTGSPQNMVNNFRILQQLNSRVV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 58/240 (24%)
LOC100496280XP_002940642.4 alpha_CA 41..272 CDD:412109 57/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.