DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ca6

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_009295179.1 Gene:ca6 / 100006448 ZFINID:ZDB-GENE-030131-7091 Length:538 Species:Danio rerio


Alignment Length:238 Identity:51/238 - (21%)
Similarity:95/238 - (39%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KQPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNF---MPQLSGAEL 132
            :|.|||.|....:........|..|.|||:..:.:::|||::|.:::.:....   .|.      
Zfish    47 QQQSPIDIQRRKVRYSPRMQQLELTGYEDIRGSFLMKNNGHSVEIQLPSTMKITKGFPH------ 105

  Fly   133 LGRYQFVEAIFKWG-----SLKSEHSIGKHNFCLELQALHRCAQLNNNFE--------YLTLSYL 184
              :|..|:....||     :..|||::....:..||..:|..::...:||        ...|::.
Zfish   106 --QYTAVQMHLHWGGWDLEASGSEHTMDGIRYMAELHVVHYNSEKYPSFEEAKNKPDGLAVLAFF 168

  Fly   185 FALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTWL 249
            |...|.:|.:......:|..|...|.|:.:...::.|:|....|.::.|:|:...........|.
Zfish   169 FEDGHFENTYYSDFISNLANIKYVGQSMSISNLNVLSMLSENLSHFYRYKGSLTTPPCFESVMWT 233

  Fly   250 INRKISVVDSRQLSEFEALYGRNGNRNCKNG-REKQPLGNRNV 291
            :......:...|:.:.|:....:.|:...|. |..|||..|.|
Zfish   234 VFDTPITLSHNQIRKLESTLMDHDNKTLWNDYRMAQPLNERVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 51/238 (21%)
ca6XP_009295179.1 alpha_CA 33..281 CDD:320708 51/238 (21%)
LamG 332..521 CDD:328935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.