DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9993 and Slc27a1

DIOPT Version :9

Sequence 1:NP_611518.1 Gene:CG9993 / 37358 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:XP_006253015.1 Gene:Slc27a1 / 94172 RGDID:620927 Length:649 Species:Rattus norvegicus


Alignment Length:533 Identity:123/533 - (23%)
Similarity:205/533 - (38%) Gaps:89/533 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TGSQLLEQSRRLAHAFQRLKLQRGDVVGISAKNTTYLTEV--------VIAALLNGTPINPLHPD 111
            |.:||...|..:|:.|.:|....||||.:..:.......:        |:|||||   :|     
  Rat   108 TFAQLDTYSNAVANLFLQLGFAPGDVVAVFLEGRPEFVGLWLGLAKAGVVAALLN---VN----- 164

  Fly   112 FDAETTAYMFEITKPKVIFCDLDNYQTLSAV-----KSSLKFKTEIILLTGTLPGVRNIQDLLAD 171
            ...|..|:....:..|.:....:....::.|     ||.|||.:..:.....||..:.:..:||:
  Rat   165 LRREPLAFCLGTSAAKALIYGGEMAAAVAEVSEQLGKSLLKFCSGDLGPESVLPDTQLLDPMLAE 229

  Fly   172 GCTGYDEKTLFACPHLCGDDTAFIITSSGVTGLPKGVTRSHRSLLNSAKI---PQLFTSDTVLFC 233
            ..|    ..|...|....||..|.|.:||.|||||.....|......|..   .....::.||:.
  Rat   230 APT----TPLAQAPGKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHSYSMRANDVLYD 290

  Fly   234 FSPLYWIS--------CIFTLLASLVNGCRRIITNRPFSVAYFADLVERHQVSFVLTVPHHMALL 290
            ..|||..:        ||...|.        ::..:.||.:.|.|...::..:.|..:......|
  Rat   291 CLPLYHSAGNIMGVGQCIIYGLT--------VVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYL 347

  Fly   291 AKSPERQELAAKMQCVQSFVCSGSKVPMGIWRQLYELLGANRFAVLYGLTETGGISKNVGGPLGS 355
            .:.|.|.  ..:...|:..|  |:.:...||.:..:..|..:....||.||......|:.|.:||
  Rat   348 LRQPVRD--VERRHHVRLAV--GNGLRPAIWEEFTQRFGVRQIGEFYGATECNCSIANMDGKVGS 408

  Fly   356 EG---RLLRNV-QVRVV-------DPHGQSLG------PNQTGQILVRLN-----LRWGGYYH-- 396
            .|   |:|.:| .:|:|       :|...|.|      |.:.|.::.::|     .|:.||..  
  Rat   409 CGFNSRILTHVYPIRLVKVNEDTMEPLRDSQGLCIPCQPGEPGLLVGQINQQDPLRRFDGYVSDS 473

  Fly   397 --NPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIEDVILHLPGVH 459
              |.:.............|:||....|:.|.::|:.|..|.|::....:...::|.|:..|.|..
  Rat   474 ATNKKIAHSVFRKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEAVLSRLLGQT 538

  Fly   460 EVAVFGIP-DEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHLSDAFHIR-------GGVFFV 516
            :|||:|:. ..|.......|:....::|.......:::.|:|.:....| :|       .|.|  
  Rat   539 DVAVYGVAVPGVEGKAGMAAIADPHNQLDPNSMYQELQKVLASYAQPIF-LRLLPQVDTTGTF-- 600

  Fly   517 DNLPKTQNSKVQR 529
                |.|.:::||
  Rat   601 ----KIQKTRLQR 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 123/533 (23%)
AFD_class_I 45..528 CDD:302604 121/530 (23%)
Slc27a1XP_006253015.1 PRK08279 45..649 CDD:236217 123/533 (23%)
AFD_class_I 107..614 CDD:302604 123/533 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.