DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9993 and Acsm5

DIOPT Version :9

Sequence 1:NP_611518.1 Gene:CG9993 / 37358 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001014184.3 Gene:Acsm5 / 361637 RGDID:1309578 Length:578 Species:Rattus norvegicus


Alignment Length:527 Identity:125/527 - (23%)
Similarity:213/527 - (40%) Gaps:76/527 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 TGEEL--TGSQLLEQSRRLAHAFQ-RLKLQRGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPD 111
            :|.|:  |..:|.:|||:.|:..: ...|:.||.:.:...........::|.:..|..:.|....
  Rat    83 SGTEVKWTFEELGKQSRKAANILEGACGLKPGDRLMLVLPRLPEWWLTIVACMRTGVVMIPGISQ 147

  Fly   112 FDAETTAYMFEITKPKVIFCD---LDNYQTLSAVKSSLKFKTEIILLTGTLPGVRNIQDLLADGC 173
            ...:...|..:..:.|.|...   ..:...:||...||  ::.:::...:.||..|.::||.   
  Rat   148 LTQKDLKYRLQAARVKSIITSDALAPHVDAISADCPSL--QSRLLVSDTSRPGWINFRELLR--- 207

  Fly   174 TGYDEKTLFACP-HLC-----GDDTAFIITSSGVTGLPKGVTRSHRS----LLNSAKIPQLFTSD 228
                    .|.| |.|     ||..|...| ||.||.||.|..|..|    .:.|.:.....|..
  Rat   208 --------VASPEHNCLRTRSGDSMAIYFT-SGTTGTPKMVEHSQCSYGLGFVASGRRLMALTES 263

  Fly   229 TVLFCFSPLYWISCIFTLLASLVNGCRRIITNRP-FSVAYFADLVERHQVSFVLTVPHHMALLAK 292
            .:.:..:...|:...:||.::..||....:...| .......:.:.|..::.:..||....||. 
  Rat   264 DIFWNTTDTGWVKAAWTLFSAWANGACVFVHELPQVDAQTILNTLCRFPITTICCVPTLFRLLV- 327

  Fly   293 SPERQELAA-KMQCVQSFVCSGSKVPMGI---WR-----QLYELLGANRFAVLYGLTETGGISKN 348
               :::|.. |.||::..:..|..:...:   |:     :::|  |       ||.:||..|..|
  Rat   328 ---QEDLTRYKFQCLRHCLAGGEALNSDVRDKWKNQTGLEIHE--G-------YGQSETVLICGN 380

  Fly   349 VGGPL---GSEGRLLRNVQVRVVDPHGQSLGPNQTGQILVRLN-----LRWGGYYHNPQETQVTV 405
            ..|..   ||.|:......|::||..|..|.|.:.|.|.:|:.     ..:..|..||::|  ..
  Rat   381 FRGSTIKSGSMGKASPPYDVQIVDEEGNVLPPGKEGNIAIRIKPTRPFCLFNCYLDNPEKT--AA 443

  Fly   406 TPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIEDVILHLPGVHEVAVFGIPDEV 470
            :..|.:.:|||..:.|::|...|..|:.||...:.:.|.|.::|..:...|.|.|.||...||.:
  Rat   444 SEQGDFYITGDRAHMDEDGYFWFVGRNDDVINSSSYRIGPVEVESALAEHPAVLESAVVSSPDPI 508

  Fly   471 STNLTACAVV-------RNEDELGAQLTEADVKGVVAQHLSDAFHIRGGVFFVDNLPKTQNSKVQ 528
            ...:....:|       .:.:.|..:|.| .||.|.|     .:.....|.|:..||||.:.|:.
  Rat   509 RGEVVKAFIVLSPAYVSHDPEALTRELQE-HVKTVTA-----PYKYPRKVAFISELPKTVSGKIL 567

  Fly   529 RRKIWSQ 535
            |.|:.:|
  Rat   568 RSKLRNQ 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 123/522 (24%)
AFD_class_I 45..528 CDD:302604 122/518 (24%)
Acsm5NP_001014184.3 AFD_class_I 48..576 CDD:418409 125/527 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333840at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.