DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9993 and ACSF3

DIOPT Version :9

Sequence 1:NP_611518.1 Gene:CG9993 / 37358 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:XP_005256350.1 Gene:ACSF3 / 197322 HGNCID:27288 Length:610 Species:Homo sapiens


Alignment Length:523 Identity:124/523 - (23%)
Similarity:201/523 - (38%) Gaps:106/523 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YSDKVMQVYDPTGEELTGSQLLEQSRRLAHAFQRL------KLQRGDVVGISAKNTTYLTEVVIA 97
            :.|::..| |..|.. |..:|..:|.||:....||      .|:...|..:.|.:.:|:. ...|
Human    53 FGDRIALV-DQHGRH-TYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDASYVV-AQWA 114

  Fly    98 ALLNGTPINPLHPDFDAETTAYMFEITKPKVIFCDLDNYQTLSAVKSSLKFKTEIILLTGTLPGV 162
            :.::|....||:....|....|:...::..|:....:..:.||.|..  |....::.||   |.:
Human   115 SWMSGGVAVPLYRKHPAAQLEYVICDSQSSVVLASQEYLELLSPVVR--KLGVPLLPLT---PAI 174

  Fly   163 RNIQDLLADGCTG-YDEKTLFACPHL-CGDDTAFIITSSGVTGLPKGVTRSH---RSLLNSAKIP 222
                      .|| .:|......|.. ..:..|.||.:||.||.||||..:|   |:::......
Human   175 ----------YTGAVEEPAEVPVPEQGWRNKGAMIIYTSGTTGRPKGVLSTHQNIRAVVTGLVHK 229

  Fly   223 QLFTSDTVLFCFSPLYWI-SCIFTLLASLVNGCRRII-----------------TNR-------P 262
            ..:|.|.|:....||:.: ..:..||..|..|...::                 |.|       |
Human   230 WAWTKDDVILHVLPLHHVHGVVNALLCPLWVGATCVMMPEFSPQQVWEKFLSSETPRINVFMAVP 294

  Fly   263 FSVAYFADLVERHQVSFVLTVPHHMALLAKSPERQELAAKMQCVQSFVCSGSKVPMGIWRQLYEL 327
            .......:..:||     .|.||....|....|.:        ::..|...:.:|:.:..:...:
Human   295 TIYTKLMEYYDRH-----FTQPHAQDFLRAVCEEK--------IRLMVSGSAALPLPVLEKWKNI 346

  Fly   328 LGANRFAVLYGLTETGGISKNVGGPL-------GSEGRLLRNVQVRVV----------------- 368
            .| :.....||:||.|   ..:.|||       ||.|..|..||||:|                 
Human   347 TG-HTLLERYGMTEIG---MALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEG 407

  Fly   369 DPHGQSLGP---NQTGQILVRLNLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQS 430
            |..|..:.|   .:.|::|||....:..|::.|:||:...|.|| |..|||...|.| |....:.
Human   408 DERGTKVTPGFEEKEGELLVRGPSVFREYWNKPEETKSAFTLDG-WFKTGDTVVFKD-GQYWIRG 470

  Fly   431 R-DTDVFKYNHFPIYPKQIEDVILHLPGVHEVAVFGIPDEV-STNLTACAVVRNEDELGAQLTEA 493
            | ..|:.|...:.:...::|..:|..|.:.:|||.|:||.. ...:||...:|.    |..|:..
Human   471 RTSVDIIKTGGYKVSALEVEWHLLAHPSITDVAVIGVPDMTWGQRVTAVVTLRE----GHSLSHR 531

  Fly   494 DVK 496
            ::|
Human   532 ELK 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 124/523 (24%)
AFD_class_I 45..528 CDD:302604 123/517 (24%)
ACSF3XP_005256350.1 MCS 55..546 CDD:341264 124/521 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.