DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9993 and ACSM2A

DIOPT Version :9

Sequence 1:NP_611518.1 Gene:CG9993 / 37358 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001295101.1 Gene:ACSM2A / 123876 HGNCID:32017 Length:577 Species:Homo sapiens


Alignment Length:528 Identity:135/528 - (25%)
Similarity:219/528 - (41%) Gaps:68/528 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GEELTGS--QLLEQSRRLAHAFQ-RLKLQRGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDF 112
            |:||..:  :|.|.|::.|:... ...|||||.|.:..........|::..:..|....|.....
Human    76 GKELMWNFRELSENSQQAANVLSGACGLQRGDRVAVVLPRVPEWWLVILGCIRAGLIFMPGTIQM 140

  Fly   113 DAETTAYMFEITKPKVIFCDLDNYQTLSAVKS---SLKFKTEIILLTGTLPGVRNIQDLLADGCT 174
            .:....|..:::|.|.|....:..|.:..|.|   ||:.|  :::...:..|..|.:.||.:..|
Human   141 KSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIK--LLVSEKSCDGWLNFKKLLNEAST 203

  Fly   175 GYDEKTLFACPHLCGDDTAFIITSSGVTGLPKGVTRSHRSLLNSAKIPQLFT---SDTVLFCFSP 236
            .:.      |......:.:.|..:||.:||||....|:.||...||:...:|   :..:::..|.
Human   204 THH------CVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISD 262

  Fly   237 LYWISCIFTLLASL-----VNGCRRIITNRPFSVAYFADLVERHQVSFVLTVP--HHMALLAKSP 294
            ..|   |..:|.||     :..|..:.....|........:..:.:..::..|  :.|.|     
Human   263 TGW---ILNILCSLMEPWALGACTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLL----- 319

  Fly   295 ERQELAA-KMQCVQSFVCSG-SKVPMGI--WRQLYELLGANRFAVLYGLTETG---GISKNVGGP 352
             :|:|:: |...:|:.|..| |.:|..:  ||....|    .....||.||||   .:||.:...
Human   320 -QQDLSSYKFPHLQNCVTVGESLLPETLENWRAQTGL----DIRESYGQTETGLTCMVSKTMKIK 379

  Fly   353 LGSEGRLLRNVQVRVVDPHGQSLGPNQTGQILVRLN-LR----WGGYYHNPQETQVTVTPDGKWL 412
            .|..|.......|:::|..|..|.|...|.|.:|:. :|    :.||..||.:|...:..| .||
Human   380 PGYMGTAASCYDVQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDKTAANIRGD-FWL 443

  Fly   413 LTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIEDVILHLPGVHEVAVFGIPDEVSTNLTAC 477
            | ||.|..|::|...|..|..|:...:.:.|.|.::|:.::..|.|.|.||...||.|...:...
Human   444 L-GDRGIKDEDGYFQFMGRANDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKA 507

  Fly   478 AVV-------RNEDELGAQLTEADVKGVVAQHLSDAFHIRGGVFFVDNLPKTQNSKVQRRKI--- 532
            .||       .:.::|..:| :..||.|.|     .:.....:.||.|||||...|:||.|:   
Human   508 FVVLASQFLSHDPEQLTKEL-QQHVKSVTA-----PYKYPRKIEFVLNLPKTVTGKIQRAKLRDK 566

  Fly   533 -WSQLSEA 539
             |....:|
Human   567 EWKMSGKA 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 132/515 (26%)
AFD_class_I 45..528 CDD:302604 130/511 (25%)
ACSM2ANP_001295101.1 AFD_class_I 40..568 CDD:388389 133/520 (26%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19345228 469..471 0/1 (0%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19345228 540..542 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S4038
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333840at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.