DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9993 and acsbg1

DIOPT Version :9

Sequence 1:NP_611518.1 Gene:CG9993 / 37358 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001121495.1 Gene:acsbg1 / 100158596 XenbaseID:XB-GENE-985321 Length:254 Species:Xenopus tropicalis


Alignment Length:249 Identity:55/249 - (22%)
Similarity:95/249 - (38%) Gaps:55/249 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKIWSGPKDKEYYGP-----DMTLGEVALIILRLYSDKVMQVYDPTG----------EELTGSQL 59
            ||:|:    .|..|.     |....:..:.:.:::.:.| ..|.|..          |.:|....
 Frog    20 EKLWT----TEANGSVQLRIDALCPQSPITVHQMFLESV-DKYGPLDALSTKRNGIWEHVTFMDY 79

  Fly    60 LEQSRRLAHAFQRLKLQRGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEIT 124
            .:..|:.|.:|.:|.|:|...|||...|:.......|..:..|..|..::.....|...|:....
 Frog    80 YKLCRQAAKSFLKLGLERFHSVGILGFNSEEWFISAIGTVFAGGIITGIYTTNSPEACHYVASDC 144

  Fly   125 KPKVIFCDLDNYQTLSAVKSSLKFKTEIILLTGTLPGVR-------NIQDLLADGCTGYDEKTLF 182
            |..:|.  ::|.:.|.          :|:.:...||.::       |:|:...:..| ::|...|
 Frog   145 KMNIIV--VENQKQLE----------KILQIWDGLPHLKAVVQYKGNLQEKRPNLYT-WEEFMEF 196

  Fly   183 ----ACPHLCGDD---------TAFIITSSGVTGLPKGVTRSHRSLLNSAKIPQ 223
                |..||  ||         ...:|.:||.||.||||..||.::.....:|:
 Frog   197 GKDIADAHL--DDIINSQKANQCCVLIYTSGTTGNPKGVMLSHDNVWGIKILPE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 51/238 (21%)
AFD_class_I 45..528 CDD:302604 48/209 (23%)
acsbg1NP_001121495.1 AFD_class_I 66..>240 CDD:302604 45/188 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.