DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and Slc27a2

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_113924.2 Gene:Slc27a2 / 65192 RGDID:71103 Length:620 Species:Rattus norvegicus


Alignment Length:556 Identity:113/556 - (20%)
Similarity:207/556 - (37%) Gaps:116/556 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QELTGAQLAQQSARIAQAF-KRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEE 116
            :.||.||:.::|.::|:|. ..||||:||.|.:...|......:.:..|..|.|:..|:.....:
  Rat    77 ETLTYAQVDRRSNQVARALHDHLGLRQGDCVALFMGNEPAYVWLWLGLLKLGCPMACLNYNIRAK 141

  Fly   117 TVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYLVNGKLEGVLDISEMLNDEDSITAAAY 181
            ::.:.:.....||:....|.:..::.|...|:..........:......:..:|:..|.::|.  
  Rat   142 SLLHCFQCCGAKVLLASPELHEAVEEVLPTLKKEGMSVFYVSRTSNTNGVDTVLDKVDGVSAD-- 204

  Fly   182 VPCPKLHGDHTAF-----IVCSSGTTGMPKGVTRSHRSLLCNCK---NPNTYTRDSVLLSFSPLY 238
             |.|:.......|     .:.:|||||:||..|.:|..|.....   .......| |:.:..|||
  Rat   205 -PIPESWRSEVTFTTPAVYIYTSGTTGLPKAATINHHRLWYGTSLALRSGIKAHD-VIYTTMPLY 267

  Fly   239 WISGTIILLASLLNGCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIALLSKHDSDVMELKAQ 303
            ..:..:|    .|:||  |:....:::        |.|    |.||.......|:::.|::...:
  Rat   268 HSAALMI----GLHGC--IVVGATFAL--------RSK----FSASQFWDDCRKYNATVIQYIGE 314

  Fly   304 L-------------QSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGYGLSEMGGLSKNVG---- 351
            |             :..:|.|..|:.:...|.|...:..|:......|..:|     .|:|    
  Rat   315 LLRYLCNTPQKPNDRDHKVKIALGNGLRGDVWREFIKRFGDIHIYEFYASTE-----GNIGFMNY 374

  Fly   352 ----GPVGCEGKVMRNVELRVLDK----------------LKMPLGINEVGIIYARLR-----FK 391
                |.||.|..:.:.|....|.|                :|:|.|  |||::..::.     |.
  Rat   375 PRKIGAVGRENYLQKKVVRHELIKYDVEKDEPVRDANGYCIKVPKG--EVGLLICKITELTPFFG 437

  Fly   392 WAGYYRNPE--ATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFIL 454
            :||.....|  ..|.......::|.:||:..:|.|.::|...|..|.|::....:...::.:.:.
  Rat   438 YAGGKTQTEKKKLRDVFKKGDVYFNSGDLLMIDRENFIYFHDRVGDTFRWKGENVATTEVADIVG 502

  Fly   455 RLPGVSEACVFGIPDAVSTNLTACAVVRTKS-----------------PEGERLTADHIRNIVEH 502
            .:..|.|..|:|:|..........|.::.|.                 |...|.....|::.:| 
  Rat   503 LVDFVEEVNVYGVPVPGHEGRIGMASIKMKENYEFNGKKLFQHISEYLPSYSRPRFLRIQDTIE- 566

  Fly   503 HLSGAYH---------------IRGGVYFIDSLPKT 523
             ::|.:.               |:..:||:|...||
  Rat   567 -ITGTFKHRKVTLMEEGFNPSVIKDTLYFMDDAEKT 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 113/556 (20%)
AFD_class_I 38..529 CDD:302604 113/556 (20%)
Slc27a2NP_113924.2 hsFATP2a_ACSVL_like 74..610 CDD:341261 113/556 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342949
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.