DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and Acsf2

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001030123.1 Gene:Acsf2 / 619561 RGDID:1562656 Length:615 Species:Rattus norvegicus


Alignment Length:569 Identity:141/569 - (24%)
Similarity:246/569 - (43%) Gaps:86/569 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TLGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAFKRLGLRRGDVVGISANNSTYL 92
            |:||.:....|...::...:.......|..|||.::..|.|.....:|||:||.:|:...||...
  Rat    73 TVGECLDATAQRFPNREALVIIHENIRLNFAQLKEEVDRAASGLLSIGLRKGDRLGMWGPNSYAW 137

  Fly    93 TSVIIAALLRGIPINPLHPEFTEETVKYMY------DITEPKVIFCDVENYHIIKTV-------- 143
            ..:.:|....||.:..::|.:....::|:.      .|..||. |...:.|:|:|.|        
  Rat   138 VLIQLATAQAGIILVSVNPAYQASELEYVLRKVGCKGIVFPKQ-FKTQQYYNILKQVCPELEKAQ 201

  Fly   144 -----NGKLQNPAKIYLVNGKLEGVLDISEML---NDEDSITAAAYVPCPKLHGDHTAFIVC--- 197
                 :.:|.:...:..|:..|.|.|.:.|::   ..|.::....|         |..|:.|   
  Rat   202 PGALKSERLPDLTTVISVDAPLPGTLLLDEVVAAGGKEQNLAQLRY---------HQGFLSCYDP 257

  Fly   198 -----SSGTTGMPKGVTRSHRSLLCN-------CKNPNTYTRDSVLLSFSPLYW----ISGTIIL 246
                 :|||||.|||.|.||.:::.|       .|.|.....:..::...|||.    :.||:: 
  Rat   258 INIQFTSGTTGNPKGATLSHHNIVNNSNLIGQRLKMPAKTAEELRMVLPCPLYHCLGSVGGTMV- 321

  Fly   247 LASLLNGCRRIITNRPYSVEYLLQLVARHKVTFLF-LASHQIALLSKHDSDVMELKAQLQSIRVL 310
              |:::|...::::..::.:..|:.::|.|.|.|: ..:..:.:|::.|....:    ..:||..
  Rat   322 --SVVHGATLLLSSPSFNGKKALEAISREKGTLLYGTPTMFVDILNQPDFSSYD----FTTIRGG 380

  Fly   311 IGAGSKVCKAVCRRMYELIGNQRFVVGYGLSE------MGGLSKNVGGPVGCEGKVMRNVELRV- 368
            :.|||.....:.|.:...:..:..||.||.:|      |......:....|..|::|.:.|.:: 
  Rat   381 VIAGSLAPPELIRAIISKMNMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTEAQIV 445

  Fly   369 ------LDKLKMPLGINEVGIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYL 427
                  |.||.||      |.:..|......||:..|:.|...:..| .|:|||||..:|.:|:.
  Rat   446 NMETGELTKLNMP------GELCIRGYCVMQGYWGEPQKTFETVGQD-RWYRTGDIASMDEQGFC 503

  Fly   428 YIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLT 492
            .|..|..|:.......|||.::|:|..:.|.|.||.|.|:.|. ......||.:|.||  ||..|
  Rat   504 RIVGRSKDMIIRGGENIYPAELEDFFHKHPQVQEAQVVGVKDD-RMGEEICACIRLKS--GETTT 565

  Fly   493 ADHIRNIVEHHLSGAYHIRGGVYFIDSLPKTPNDKLQRRKVLGLVQQLE 541
            .:.|:...:..:| .:.|...:.|::..|.|.:.|:|:.|   |.:|:|
  Rat   566 EEEIKAFCKGKIS-HFKIPRYIVFVEGYPLTVSGKIQKFK---LREQME 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 141/569 (25%)
AFD_class_I 38..529 CDD:302604 133/545 (24%)
Acsf2NP_001030123.1 PRK08315 57..615 CDD:236236 141/569 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.