DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and Acsm5

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001014184.3 Gene:Acsm5 / 361637 RGDID:1309578 Length:578 Species:Rattus norvegicus


Alignment Length:511 Identity:121/511 - (23%)
Similarity:214/511 - (41%) Gaps:50/511 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TGQEL--TGAQLAQQSARIAQAFK-RLGLRRGD--VVGISANNSTYLTSVIIAALLRGIPINPLH 110
            :|.|:  |..:|.:||.:.|...: ..||:.||  ::.:......:||  |:|.:..|:.:.|..
  Rat    83 SGTEVKWTFEELGKQSRKAANILEGACGLKPGDRLMLVLPRLPEWWLT--IVACMRTGVVMIPGI 145

  Fly   111 PEFTEETVKYMYDITEPK-VIFCDVENYHI--IKTVNGKLQNPAKIYLVNGKLEGVLDISEMLND 172
            .:.|::.:||.......| :|..|....|:  |......||  :::.:.:....|.::..|:|. 
  Rat   146 SQLTQKDLKYRLQAARVKSIITSDALAPHVDAISADCPSLQ--SRLLVSDTSRPGWINFRELLR- 207

  Fly   173 EDSITAAAYVPCPKLHGDHTAFIVCSSGTTGMPKGVTRSHRS----LLCNCKNPNTYTRDSVLLS 233
                .|:....|.:.....:..|..:|||||.||.|..|..|    .:.:.:.....|...:..:
  Rat   208 ----VASPEHNCLRTRSGDSMAIYFTSGTTGTPKMVEHSQCSYGLGFVASGRRLMALTESDIFWN 268

  Fly   234 FSPLYWISGTIILLASLLNGCRRIITNRP-YSVEYLLQLVARHKVTFLFLASHQIALLSKHDSDV 297
            .:...|:.....|.::..||....:...| ...:.:|..:.|..:|.:........||.:.|.  
  Rat   269 TTDTGWVKAAWTLFSAWANGACVFVHELPQVDAQTILNTLCRFPITTICCVPTLFRLLVQEDL-- 331

  Fly   298 MELKAQLQSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGYGLSEMGGLSKNVGGPV---GCEGK 359
              .:.:.|.:|..: ||.:...:..|..::.........|||.||...:..|..|..   |..||
  Rat   332 --TRYKFQCLRHCL-AGGEALNSDVRDKWKNQTGLEIHEGYGQSETVLICGNFRGSTIKSGSMGK 393

  Fly   360 VMRNVELRVLDKLKMPLGINEVGIIYARLR-------FKWAGYYRNPEATRRALSSDGMWFRTGD 417
            .....:::::|:....|...:.|.|..|::       |..  |..|||.|  |.|..|.::.|||
  Rat   394 ASPPYDVQIVDEEGNVLPPGKEGNIAIRIKPTRPFCLFNC--YLDNPEKT--AASEQGDFYITGD 454

  Fly   418 IGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVR 482
            ..::|.:||.:...|:.||...::::|.|.::|..:...|.|.|:.|...||.:...:....:|.
  Rat   455 RAHMDEDGYFWFVGRNDDVINSSSYRIGPVEVESALAEHPAVLESAVVSSPDPIRGEVVKAFIVL 519

  Fly   483 TK---SPEGERLTADHIRNIVEH--HLSGAYHIRGGVYFIDSLPKTPNDKLQRRKV 533
            :.   |.:.|.||    |.:.||  .::..|.....|.||..||||.:.|:.|.|:
  Rat   520 SPAYVSHDPEALT----RELQEHVKTVTAPYKYPRKVAFISELPKTVSGKILRSKL 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 121/511 (24%)
AFD_class_I 38..529 CDD:302604 119/505 (24%)
Acsm5NP_001014184.3 AFD_class_I 48..576 CDD:418409 121/511 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333840at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.