DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and hll

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_609696.1 Gene:hll / 34822 FlyBaseID:FBgn0286723 Length:681 Species:Drosophila melanogaster


Alignment Length:646 Identity:138/646 - (21%)
Similarity:230/646 - (35%) Gaps:177/646 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SCEVHYDAASRTWFGP-RGKDFYGPEMTLGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSA 65
            |||.:.|..:..|..| .|.|.: ..:|.||...||                         :|:|
  Fly    45 SCEKYSDLPALVWETPGSGNDGW-TTLTFGEYQERV-------------------------EQAA 83

  Fly    66 RIAQAFKRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKV- 129
            .:..:   :|:.....|||.|.|..........||..|..:..::|..:.|.|.::....|..| 
  Fly    84 LMLLS---VGVEERSSVGILAFNCPEWFFAEFGALRAGAVVAGVYPSNSAEAVHHVLATGESSVC 145

  Fly   130 IFCDVENYHIIKTVNGKLQNPAKIYLVNGKLEGVLD-------------------ISEMLNDEDS 175
            :..|.:....::.:..:|.....:..::|..|..:|                   :.|.|...:|
  Fly   146 VVDDAQQMAKLRAIKERLPRLKAVIQLHGPFEAFVDHEPGYFSWQKLQEQTFSSELKEELLARES 210

  Fly   176 ITAAAYVPCPKLHGDHTAFIVCSSGTTGMPKGVTRSHRSLLCNCKNPNTYTRD-----SVLLSFS 235
                      ::..:..|.::.:|||.||||.|..||.:|:.:.|:...:.:|     ...:|:.
  Fly   211 ----------RIRANECAMLIFTSGTVGMPKAVMLSHDNLVFDTKSAAAHMQDIQVGKESFVSYL 265

  Fly   236 PLYWISGTII-------------------LLASLLNGCRRIITNRPYSV--------EYLLQLVA 273
            ||..::..|.                   |..:|:...|:....:.:.|        |.|:...|
  Fly   266 PLSHVAAQIFDVFLGLSHAGCVTFADKDALKGTLIKTFRKARPTKMFGVPRVFEKLQERLVAAEA 330

  Fly   274 RHKVTFLFLASHQIALLSKHDSDVMELKAQ--------------LQSIRVLIGAGSKVCKAVCRR 324
            :.:.....|.:...|.:::|.:.:|..|:.              ::.||.:||..:      ||.
  Fly   331 KARPYSRLLLARARAAVAEHQTTLMAGKSPSIYGNAKYWLACRVVKPIREMIGVDN------CRV 389

  Fly   325 MY--------ELIGNQRFVVG--------YGLSEMGG-------LSKNVGGPVGCEGKVMRNVEL 366
            .:        ||   ::|.:|        ||:||..|       :|........|||..:     
  Fly   390 FFTGGAPTSEEL---KQFFLGLDIALGECYGMSETSGAITLNVDISNLYSAGQACEGVTL----- 446

  Fly   367 RVLDKLKMPLGINEVGIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQT 431
                |:..| ..|..|.|..|.|..:.||...|:.|...:..|| |..:||:||:|.:|.|.|..
  Fly   447 ----KIHEP-DCNGQGEILMRGRLVFMGYLGLPDKTEETVKEDG-WLHSGDLGYIDPKGNLIISG 505

  Fly   432 RDTD-VFKFNNFQIYPEQIEEFILR-LPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTAD 494
            |..: :.......|.|..|||.|.: ||.||...:.|   .....||....::||......:..|
  Fly   506 RLKELIITAGGENIPPVHIEELIKKELPCVSNVLLIG---DHRKYLTVLLSLKTKCDAKTGIPLD 567

  Fly   495 HIR----------NIVEHHLSGAYHIRGGVYFIDSLPKTPNDKLQRRKVLGLVQQLELKAE 545
            .:|          :|.|..||...:|...:       :.|||      ...|...||:.|:
  Fly   568 ALREETIEWLRDLDIHETRLSELLNIPADL-------QLPND------TAALAATLEITAK 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 129/620 (21%)
AFD_class_I 38..529 CDD:302604 121/591 (20%)
hllNP_609696.1 AFD_class_I 62..680 CDD:388389 132/629 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.