DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and ACSM2B

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001098539.1 Gene:ACSM2B / 348158 HGNCID:30931 Length:577 Species:Homo sapiens


Alignment Length:521 Identity:122/521 - (23%)
Similarity:213/521 - (40%) Gaps:72/521 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GQELTG-----AQLAQQSARIAQAFKRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHP 111
            |:||..     ::.:||:|.|...  ..||:|||.|.:..........||:..:..|:...|...
Human    76 GKELMWNFRELSENSQQAANILSG--ACGLQRGDRVAVMLPRVPEWWLVILGCIRAGLIFMPGTI 138

  Fly   112 EFTEETVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYLVNGK-LEGVLDISEMLNDEDS 175
            :.....:.|...:::.|.|....|....:.||..:..:.....||:.| .:|.|:..::||:   
Human   139 QMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKSCDGWLNFKKLLNE--- 200

  Fly   176 ITAAAYVPCPKLHGDHTAFIVCSSGTTGMPKGVTRSHRSLLCNCKNPNTYT---RDSVLLSFSPL 237
              |:....|.:......:.|..:|||:|:||....|:.||....|....:|   ...::.:.|..
Human   201 --ASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISDT 263

  Fly   238 YWISGTIILLASL-----LNGCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIALLSKHDSDV 297
            .||   :.:|.||     |..|..:.....:....:|:.::.:.:..:..|.....:|.:.|...
Human   264 GWI---LNILGSLLESWTLGACTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQQDLSS 325

  Fly   298 MELKAQLQSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVG------YGLSEMG---GLSKNVGGP 353
            .:. ..||:  .|.|..|        .:.|.:.|.|...|      ||.:|.|   .:||.:...
Human   326 YKF-PHLQN--CLAGGES--------LLPETLENWRAQTGLDIREFYGQTETGLTCMVSKTMKIK 379

  Fly   354 VGCEGKVMRNVELRVLDKL--KMPLGI-NEVGIIYARLRFK-------WAGYYRNPEATRRALSS 408
            .|..|......:::|:|..  .:|.|. .::||     |.|       ::||..||:.|...:..
Human   380 PGYMGTAASCYDVQVIDDKGNVLPPGTEGDIGI-----RVKPIRPIGIFSGYVENPDKTAANIRG 439

  Fly   409 DGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGIPDAVST 473
            | .|. .||.|..|.:||.....|..|:...:.::|.|.::|..:::.|.|.|..|...||.|..
Human   440 D-FWL-LGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVENALMKHPAVVETAVISSPDPVRG 502

  Fly   474 NLTACAVVRTK---SPEGERLTAD---HIRNIVEHHLSGAYHIRGGVYFIDSLPKTPNDKLQRRK 532
            .:....|:...   |.:.|:||.:   |::::     :..|.....:.|:.:||||...|:||.|
Human   503 EVVKAFVILASQFLSHDPEQLTKELQQHVKSV-----TAPYKYPRKIEFVLNLPKTVTGKIQRTK 562

  Fly   533 V 533
            :
Human   563 L 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 122/521 (23%)
AFD_class_I 38..529 CDD:302604 119/515 (23%)
ACSM2BNP_001098539.1 AFD_class_I 40..568 CDD:388389 122/521 (23%)
Coenzyme A binding. /evidence=ECO:0000250 469..471 0/1 (0%)
Coenzyme A binding. /evidence=ECO:0000250 540..542 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333840at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.