DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and CG18155

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_996360.2 Gene:CG18155 / 31668 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster


Alignment Length:555 Identity:107/555 - (19%)
Similarity:212/555 - (38%) Gaps:148/555 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RIAQAFKRLGLRRGDVVGISA-NNSTYLTS-------VIIAALLRGIPINPLHPEFTEETVKYMY 122
            ::..|.||||::..::.|.:| :|.|||.|       :..:..:.|....||......:.::...
  Fly    73 QLYMAAKRLGIQISNICGGAALSNVTYLCSNNALWIAIQWSCWISGQVAVPLESGQAIDQLQRQA 137

  Fly   123 DITEPKVIFCDVENYHIIKTVNGKLQNPAKIYLVNGKL-------------EGVLDISEMLNDED 174
            ...:.|::....|...:.:.::..::: |.|.|.:..|             :.::.|..::..|:
  Fly   138 SNCKTKLLIATKEFESLAQELSQGVKS-ATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTEN 201

  Fly   175 SITAAAYVPCPKLHGDHTAFIVCSSGTTGMPKGVTRSHRS----LLC----------NCKNPNTY 225
            :.....|...|       |.::.:......||.|..:||:    :.|          :|..|   
  Fly   202 TFPNDFYSKAP-------AMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWHLGPTDCMLP--- 256

  Fly   226 TRDSVLLSFSPLY-------WISGTIILLASLLNGCRRIITNRPYSVEYLLQLVARHKVTFLFLA 283
                 :||.:.::       .:.|.::|.       ::...:..:|....:...::.:|| ||||
  Fly   257 -----ILSMNRMHAALAAVLSVGGNVVLQ-------QKFDGHNAWSALLGINSPSKQRVT-LFLA 308

  Fly   284 SHQI--ALLSKH------DSDVME--LKAQLQSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGY 338
            ...:  .|:.::      ||.::|  :....|.||::..|.:.:..:|..|..|:.| |.....|
  Fly   309 MPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITG-QNIYEYY 372

  Fly   339 GLSEMG-----GLSKNV-----GGPV---------------GCEGKVMRNVELRVL----DKL-- 372
            |:.|.|     .|:|..     .||.               |..|..::.|..|::    |:|  
  Fly   373 GMMETGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELIT 437

  Fly   373 -KMPLG---------INEV-------GIIYARLRFKWAGYYRNPEAT--------------RRAL 406
             |..||         :.::       |.|...|:...:....|..|.              .:..
  Fly   438 CKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQEN 502

  Fly   407 SSDGMWFRTGDI-GYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGIPDA 470
            :.|| :|:|||| .|  ..|..|..::.:|:|....:::|..:|::.::..|.:::..|.|||:.
  Fly   503 NQDG-FFKTGDICAY--RNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNK 564

  Fly   471 V-STNLTACAVVRTKSPEGERLTADHIRNIVEHHL 504
            : ...|....:|   ||:.: :..|.|:.....||
  Fly   565 MWGHRLGVICIV---SPDAD-IDLDAIKTYCYRHL 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 107/555 (19%)
AFD_class_I 38..529 CDD:302604 107/555 (19%)
CG18155NP_996360.2 CaiC 53..604 CDD:223395 107/555 (19%)
AFD_class_I 58..607 CDD:302604 107/555 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.