DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and LOC316124

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_006244385.1 Gene:LOC316124 / 316124 RGDID:1595856 Length:705 Species:Rattus norvegicus


Alignment Length:553 Identity:129/553 - (23%)
Similarity:220/553 - (39%) Gaps:148/553 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QELTGAQLAQQSARIAQAFKRLGLRRGDVVGI-SANNSTYLTSVIIAALLRGIPINPLHPEFTEE 116
            |.||..:..:...|.|:||.::||.|...||| ..|:|.::.:.|.|.:..||.:..|... :.:
  Rat   101 QVLTYIEYYEACRRAAKAFLKVGLERFHGVGIMGINSSEWVIASIGAIMAGGISVGILSSN-SPK 164

  Fly   117 TVKYMYDITEPKVIFCD----------VENYHIIKTVNGKLQNPAKIYLVNGKL---EGVLDISE 168
            ..:.:.:.:|..:...|          ::.|  :|.:...:|....|..|...|   :|.||:::
  Rat   165 ACQIIAETSEMDIFVVDNDRQLQKVNQIQGY--LKHLKAIIQYREDIQEVQPNLYSWKGFLDLAD 227

  Fly   169 MLNDE--DSITAAAYVPCPKLHGDHTAFIVCSSGTTGMPKGVTRSHRSLLCNCKNPNTYTR---- 227
            .::||  |.|..|.       ..:....:|.:.||||.||.:..||.::        |:|.    
  Rat   228 GISDEKLDQIIDAQ-------KPNQCCALVYNQGTTGNPKAIMLSHDNI--------TWTTAATV 277

  Fly   228 -----------DSVLLSFSPL---------YW----ISGTII---LLASLLNGCRRIITNRPYSV 265
                       ..:|:|:.||         .|    ::||:.   |.:...:|..|:     ...
  Rat   278 QSLGYKCPPHGQEILVSYLPLCFAGIQILDVWVAISVAGTVYFPSLESGKWSGLPRV-----SGT 337

  Fly   266 EYLLQLVARHKVTFLFLASHQI------ALLSKH-DSDVMELKAQLQSIR---------VLIGAG 314
            .:|::|:...:.| .|.....:      :|.:|| ||.....|....::|         ::.|..
  Rat   338 GFLMELLREVQPT-TFCGIPWVWDRMLDSLKTKHLDSTAFRRKIDRWAMRMGLSTNKRQMMGGIH 401

  Fly   315 SKVCKAVCRRM-----YELIG----NQRFVVG---------------------YGLSEMGG---L 346
            ..:|..:.:|:     .:.:|    .|...||                     |||||..|   |
  Rat   402 QPLCFGLAKRLTFKPAKKFLGLNHCEQFLNVGMGLPRSTLDFFLSMNIPILELYGLSECTGLHTL 466

  Fly   347 SKNVGGPVGCEGKVMRNVELRVLDKLKMPLGINEVGI----IYARLRFKWAGYYRNPEATRRALS 407
            |......:...||.:.....:|..:       |:.|:    |:.|..|  .||.|:..:|.|.:.
  Rat   467 SSLQAYRILSSGKALPKTHTKVEKE-------NQDGVGNLCIWGRHVF--MGYLRDKHSTERKVD 522

  Fly   408 SDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQ-IYPEQIEEFI-LRLPGVSEACVFGIPDA 470
            :.| |..|.|:|:||.:.|||:.....|:.:.|:.: :.|..|||.: .|:|.|..|.:.| .||
  Rat   523 NHG-WLHTNDLGFLDFDKYLYVTGNTNDLIRLNSGEMVNPIPIEERVRTRIPLVRYAMLVG-QDA 585

  Fly   471 VSTNLTACAVVRTK---SPE-GE---RLTADHI 496
            .    ..||::..|   :|| ||   .||::.|
  Rat   586 P----YLCALLTLKCQINPETGEAQGNLTSEAI 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 129/553 (23%)
AFD_class_I 38..529 CDD:302604 129/553 (23%)
LOC316124XP_006244385.1 FAA1 74..701 CDD:223953 129/553 (23%)
ACSBG_like 95..700 CDD:213299 129/553 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.