DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and Slc27a3

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001099909.1 Gene:Slc27a3 / 295219 RGDID:1310605 Length:667 Species:Rattus norvegicus


Alignment Length:447 Identity:97/447 - (21%)
Similarity:166/447 - (37%) Gaps:76/447 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GQELTGAQLAQQSARIAQAFKRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEE 116
            |.|..........|.:..||....||||.:  :....|...::|::|.            ||.|.
  Rat   161 GPEFLWLWFGLAKAGLRTAFVPSALRRGPL--LHCLRSCGASAVVLAT------------EFLES 211

  Fly   117 TVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYLVNGKLEGVLD-ISEMLNDEDSITAAA 180
                    .||.:........|:..|..|.            .|.|:.: :||.....|. ....
  Rat   212 --------LEPDLPALRAMGLHLWATGPGT------------NLAGISNLLSEAATQVDE-PVPG 255

  Fly   181 YVPCPKLHGDHTAFIVCSSGTTGMPKGVTRSHRSLLCNCKN----PNTYTRDSVLLSFSPLYWIS 241
            |:..|:...| |...:.:|||||:||....||..:| .|:.    ...:..|.:.|:. |||.:|
  Rat   256 YLSAPQNIMD-TCLYIFTSGTTGLPKAARVSHLKVL-QCQGFYQLCGVHQEDVIYLAL-PLYHMS 317

  Fly   242 GTIILLASLLNGCRRIITNRPYSVEYLLQLVARHKVT-FLFLASHQIALLSKHDSDVMELKAQL- 304
            |:::.:...|.....::....:|.....:...||.|| |.::......|:::..|     ||:. 
  Rat   318 GSLLGIVGCLGIGATVVLKPKFSASQFWEDCQRHGVTVFQYIGELCRYLVNQPPS-----KAECG 377

  Fly   305 QSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGYGLSEMGGLSKNVGGPVGCEGK---------- 359
            ..:|:.:|:|.:  .....|.....|..:.:..||.:|....:.|..|..|..|:          
  Rat   378 HKVRLAVGSGLR--PDTWDRFVRRFGPLQILETYGATEGNVATFNYTGQQGAVGRASWLYKHIFP 440

  Fly   360 -------VMRNVELRVLDKLKMPLGINEVGIIYARL--RFKWAGYYRNPEATRRALSSD-----G 410
                   ||....:|......|.....|.|::.|.:  ...:.||...||..:..|..|     .
  Rat   441 FSLIRYDVMTGEPIRNAQGHCMAASPGEPGLLVAPVSQESPFLGYAGAPELAQEKLLKDVFRPGD 505

  Fly   411 MWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGI 467
            ::|.|||:...|.:|:|:...|..|.|::....:...::.|.:..|..:.|..::|:
  Rat   506 IFFNTGDLLVCDEQGFLHFHDRTGDTFRWKGENVATTEVAEVLEALDFLQEVNIYGV 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 97/447 (22%)
AFD_class_I 38..529 CDD:302604 97/447 (22%)
Slc27a3NP_001099909.1 PRK08279 60..666 CDD:236217 97/447 (22%)
AFD_class_I 91..657 CDD:302604 97/447 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.