DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and SLC27A6

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001017372.1 Gene:SLC27A6 / 28965 HGNCID:11000 Length:619 Species:Homo sapiens


Alignment Length:568 Identity:116/568 - (20%)
Similarity:203/568 - (35%) Gaps:140/568 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GQELTGAQLAQQSARIAQAF-KRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTE 115
            |...|...:.::|:|:|..| ....|::||.|.:..:|......|.......|..:..|:.....
Human    77 GDIYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALLMSNEPDFVHVWFGLAKLGCVVAFLNTNIRS 141

  Fly   116 ETVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYLVNGKL-EGVLDISEMLN---DEDSI 176
            .::........|:.:....:....::.:...|.....::.:...: :||:.:.|.|:   ||   
Human   142 NSLLNCIRACGPRALVVGADLLGTVEEILPSLSENISVWGMKDSVPQGVISLKEKLSTSPDE--- 203

  Fly   177 TAAAYVPCPKLHGDH-------TAFIVCSSGTTGMPKGVTRSHRSLLCNCKNPNTYTRDSVLLSF 234
                  |.|:.|  |       |...:.:|||||:||....|...:|         ...:||.:|
Human   204 ------PVPRSH--HVVSLLKSTCLYIFTSGTTGLPKAAVISQLQVL---------RGSAVLWAF 251

  Fly   235 S-----------PLYWISGTIILLASLLNGCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIA 288
            .           |||..|..|:    .::||          ||.....|.:.|    |.||...:
Human   252 GCTAHDIVYITLPLYHSSAAIL----GISGC----------VELGATCVLKKK----FSASQFWS 298

  Fly   289 LLSKHDSDVMELKAQL---------------QSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGY 338
            ...|:|..|.:...:|               ..:|:.||.|  :...|.|...:..||.:....|
Human   299 DCKKYDVTVFQYIGELCRYLCKQSKREGEKDHKVRLAIGNG--IRSDVWREFLDRFGNIKVCELY 361

  Fly   339 GLSEMGGLSKNVGGPVGCEG------KVMRNVELRVLDKLK-----------MPLGINEVGIIYA 386
            ..:|......|..|.:|..|      |::...:|...|..|           :.:...|.|::.:
Human   362 AATESSISFMNYTGRIGAIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGEPGLLIS 426

  Fly   387 RLR-----FKWAGYYRNPEATRRALSSD-----GMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNN 441
            |:.     |.:||.|::   |:..|..|     .::..|||:...|.:.:||...|..|.|::..
Human   427 RVNAKNPFFGYAGPYKH---TKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRTGDTFRWKG 488

  Fly   442 FQIYPEQIEEFILRLPGVSEACVFGIP---------------------------DAVSTNLTACA 479
            ..:...::.:.|..|..:.||.|:|:.                           :.|.|.|.|.|
Human   489 ENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQVVTFLPAYA 553

  Fly   480 VVRTKSPEGERLTADHIRNIVEHHL----SGAYHIRGGVYFIDSLPKT 523
            ..|....: |::.|.....:::|.|    .....|...:||:|:|.|:
Human   554 CPRFLRIQ-EKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKS 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 116/568 (20%)
AFD_class_I 38..529 CDD:302604 116/568 (20%)
SLC27A6NP_001017372.1 PRK08279 16..619 CDD:236217 116/568 (20%)
hsFATP2a_ACSVL_like 77..609 CDD:213304 116/568 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.