DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and DIP2A

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_011527794.1 Gene:DIP2A / 23181 HGNCID:17217 Length:1607 Species:Homo sapiens


Alignment Length:604 Identity:122/604 - (20%)
Similarity:208/604 - (34%) Gaps:164/604 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 TTGQELTGAQLAQQSARIAQAFKRLG-LRRGDVVGISANNSTYLTSVIIAALLRG---IPINPLH 110
            |.....|..||.:::.|:|.|....| |..||.|.:.......|.:.....|..|   :.:.|.|
Human  1048 TVTSTATCVQLHKRAERVAAALMEKGRLSVGDHVALVYPPGVDLIAAFYGCLYCGCVPVTVRPPH 1112

  Fly   111 PE---FTEETVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYLVNGKLEGVLDI---SEM 169
            |:   .|..|||.:.::::..   |.:....:.:.:..|            :....:||   ..:
Human  1113 PQNLGTTLPTVKMIVEVSKSA---CVLTTQAVTRLLRSK------------EAAAAVDIRTWPTI 1162

  Fly   170 LNDED----SITAAAYVPCPKLHGDHTAFIVCSSGTTGMPKGVTRSH-------RSLLCNCKNPN 223
            |:.:|    .|.:....|.|    |..|::..|..|||:..||..||       ||:...|:   
Human  1163 LDTDDIPKKKIASVFRPPSP----DVLAYLDFSVSTTGILAGVKMSHAATSALCRSIKLQCE--- 1220

  Fly   224 TYTRDSVLLSFSPLYWISGTIILLASLLNGCRRIIT---NRPYSVEYLLQLVARHKVTFLFLASH 285
            .|....:.:...|...:...:..|.|:.:|.:.::.   ....:|...|..|:::|....|.:..
Human  1221 LYPSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLVPPLELESNVSLWLSAVSQYKARVTFCSYS 1285

  Fly   286 QIALLSK---HDSDVMELK-AQLQSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGYGLSEMGGL 346
            .:.:.:|   ..:.|:.:| ..|..:|        .|..|......:...|.|         ..|
Human  1286 VMEMCTKGLGAQTGVLRMKGVNLSCVR--------TCMVVAEERPRIALTQSF---------SKL 1333

  Fly   347 SKNVGGPV-------GC----------------------------------------------EG 358
            .|::|.|.       ||                                              .|
Human  1334 FKDLGLPARAVSTTFGCRVNVAICLQGTAGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESG 1398

  Fly   359 KVMRNVELRVL-DKLKMPLGINEVGIIYARLRFKWAGYYRNPEATRRALSSD------------G 410
            |::..|::.:. .:.|.|||.:.:|.|:........|||  ......||.:|            .
Human  1399 KILPGVKVIIAHTETKGPLGDSHLGEIWVSSPHNATGYY--TVYGEEALHADHFSARLSFGDTQT 1461

  Fly   411 MWFRTGDIGYL------DSEG----YLYIQTRDTDVFKFNNFQIYPEQIEEFILRL-PGVSEACV 464
            :|.|||.:|:|      |:.|    .||:.....:..:....:.:|..||..::|. ..::|..|
Human  1462 IWARTGYLGFLRRTELTDASGGRHDALYVVGSLDETLELRGMRYHPIDIETSVIRAHRSIAECAV 1526

  Fly   465 FGIPDAVSTNLTACAVVRTKSPEGERL-TADHIRNIV--EHHLSGAYHIRGGVYFIDS--LPKTP 524
            |     ..|||.. .||.....|.:.| ....:.|:|  ||:|     :.|.|..:|.  :|...
Human  1527 F-----TWTNLLV-VVVELDGLEQDALDLVALVTNVVLEEHYL-----VVGVVVIVDPGVIPINS 1580

  Fly   525 NDKLQRRKVLG--LVQQLE 541
            ..:.||..:..  |..||:
Human  1581 RGEKQRMHLRDGFLADQLD 1599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 122/604 (20%)
AFD_class_I 38..529 CDD:302604 117/588 (20%)
DIP2AXP_011527794.1 DMAP_binding 9..158 CDD:283995
CaiC 360..959 CDD:223395
AFD_class_I 392..956 CDD:302604
AMP-binding 1027..1501 CDD:278902 94/493 (19%)
AFD_class_I 1044..1596 CDD:302604 120/599 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.