DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and SLC27A2

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_003636.2 Gene:SLC27A2 / 11001 HGNCID:10996 Length:620 Species:Homo sapiens


Alignment Length:558 Identity:101/558 - (18%)
Similarity:206/558 - (36%) Gaps:122/558 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QELTGAQLAQQSARIAQAF-KRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEE 116
            :.||.||:.::|.::|:|. ..||||:||.|.:...|......:.:..:..|..:..|:.....:
Human    77 ETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLGLVKLGCAMACLNYNIRAK 141

  Fly   117 TVKYMYDITEPKVIFCDVENYHIIKTVNGKL-QNPAKIYLVNGKLEGVLDISEMLNDEDSITAAA 180
            ::.:.:.....||:....|....::.:...| ::...||.|: :......|...|:..|.::.. 
Human   142 SLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVS-RTSNTDGIDSFLDKVDEVSTE- 204

  Fly   181 YVPCPKLHGDHTAF-----IVCSSGTTGMPKGVTRSHR--------SLLCNCKNPNTYTRDSVLL 232
              |.|:.......|     .:.:|||||:||....:|:        :.:...|      .|.|:.
Human   205 --PIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLK------ADDVIY 261

  Fly   233 SFSPLYWISGTIILLASLLNGCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIALL-----SK 292
            ...|.|..:..:|.:...:.....:.....:|.........::.||.:......:..|     ..
Human   262 ITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKP 326

  Fly   293 HDSDVMELKAQLQSIRVLIGAGSK--VCKAVCRR-----MYELIGNQRFVVGYGLSEMGGLSKNV 350
            :|.|        ..:|:.:|.|.:  |.:...:|     :||........:|:         .|.
Human   327 NDRD--------HKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGF---------MNY 374

  Fly   351 GGPVGCEGKVMRNVELRVL--DKLK------------------MPLGINEVGIIYARLR------ 389
            ...||..|:| ..::.:::  |.:|                  :|.|  |||::..::.      
Human   375 ARKVGAVGRV-NYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG--EVGLLVCKITQLTPFN 436

  Fly   390 -FKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFI 453
             :..|......:..|.......::|.:||:..:|.|.::|...|..|.|::....:...::.:.:
Human   437 GYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTV 501

  Fly   454 LRLPGVSEACVFG--IPDAVSTNLTACAVVRTKSP---EGERL---TADH-----------IRNI 499
            ..:..|.|..|:|  :||  .......|.::.|..   :|::|   .||:           |::.
Human   502 GLVDFVQEVNVYGVHVPD--HEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDT 564

  Fly   500 VEHHLSGAYH---------------IRGGVYFIDSLPK 522
            :|  ::|.:.               |:..:||:|...|
Human   565 IE--ITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAK 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 101/558 (18%)
AFD_class_I 38..529 CDD:302604 101/558 (18%)
SLC27A2NP_003636.2 hsFATP2a_ACSVL_like 74..610 CDD:341261 101/558 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.