DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and SLC27A3

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_077306.3 Gene:SLC27A3 / 11000 HGNCID:10997 Length:683 Species:Homo sapiens


Alignment Length:446 Identity:97/446 - (21%)
Similarity:171/446 - (38%) Gaps:74/446 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GQELTGAQLAQQSARIAQAFKRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEE 116
            |.|..........|.:..||....||||.::..       |.|....||:       |.|||.|.
Human   177 GPEFLWLWFGLAKAGLRTAFVPTALRRGPLLHC-------LRSCGARALV-------LAPEFLES 227

  Fly   117 TVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYLVNGKLEGVLDISEMLNDEDSITAAAY 181
                    .||.:........|:  ...|...:||          |:.|:...::.|.......|
Human   228 --------LEPDLPALRAMGLHL--WAAGPGTHPA----------GISDLLAEVSAEVDGPVPGY 272

  Fly   182 VPCPKLHGDHTAFIVCSSGTTGMPKGVTRSHRSLLCNCKN----PNTYTRDSVLLSFSPLYWISG 242
            :..|:...| |...:.:|||||:||....||..:| .|:.    ...:..|.:.|:. |||.:||
Human   273 LSSPQSITD-TCLYIFTSGTTGLPKAARISHLKIL-QCQGFYQLCGVHQEDVIYLAL-PLYHMSG 334

  Fly   243 TIILLASLLNGCRRIITNRPYSVEYLLQLVARHKVT-FLFLASHQIALLSKHDSDVMELKAQL-Q 305
            :::.:...:.....::....:|.....:...:|:|| |.::......|:::..|     ||:. .
Human   335 SLLGIVGCMGIGATVVLKSKFSAGQFWEDCQQHRVTVFQYIGELCRYLVNQPPS-----KAERGH 394

  Fly   306 SIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGYGLSEMGGLSKNVGGPVGCEGKV---------- 360
            .:|:.:|:|.:  .....|.....|..:.:..|||:|....:.|..|..|..|:.          
Human   395 KVRLAVGSGLR--PDTWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPF 457

  Fly   361 -MRNVELRVLDKLKMPLG------INEVGIIYARL--RFKWAGYYRNPEATRRALSSD-----GM 411
             :...::...:.::.|.|      ..|.|::.|.:  :..:.||...||..:..|..|     .:
Human   458 SLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFRPGDV 522

  Fly   412 WFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGI 467
            :|.|||:...|.:|:|....|..|.|::....:...::.|....|..:.|..|:|:
Human   523 FFNTGDLLVCDDQGFLRFHDRTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGV 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 97/446 (22%)
AFD_class_I 38..529 CDD:302604 97/446 (22%)
SLC27A3NP_077306.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..145
hsFATP2a_ACSVL_like 163..673 CDD:213304 97/446 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.