Sequence 1: | NP_611511.3 | Gene: | CG13442 / 37349 | FlyBaseID: | FBgn0034546 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_612405.2 | Gene: | MARCHF9 / 92979 | HGNCID: | 25139 | Length: | 346 | Species: | Homo sapiens |
Alignment Length: | 256 | Identity: | 58/256 - (22%) |
---|---|---|---|
Similarity: | 92/256 - (35%) | Gaps: | 80/256 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 CYDKDGTTADAE----DPQIPACSLGLKPNVQFQKLPHPSHPLVSTEAVLAAATSSSYSAGPPKA 127
Fly 128 AATDSIATLRHCVDGATQCNNLNYESASNESMPSVGSLVCRICHNADNPEQLVSPCLCKGSLTYV 192
Fly 193 HVHCLECWISTSRCTTCELCQFQY-----NTEQTLRYTCLQ-----------------------S 229
Fly 230 LRLWYSRAMSRRALQED-----CQ-MFSLLTLVAFGIIGTLLVGIQYYALHTHSWGLSKLW 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13442 | NP_611511.3 | AmyAc_family | <36..>151 | CDD:298606 | 19/87 (22%) |
RINGv | 166..213 | CDD:128983 | 20/46 (43%) | ||
MARCHF9 | NP_612405.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 20..39 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 47..92 | 10/46 (22%) | |||
RINGv | 109..155 | CDD:128983 | 19/50 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 273..301 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 326..346 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5183 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |