DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and MARCHF9

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_612405.2 Gene:MARCHF9 / 92979 HGNCID:25139 Length:346 Species:Homo sapiens


Alignment Length:256 Identity:58/256 - (22%)
Similarity:92/256 - (35%) Gaps:80/256 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CYDKDGTTADAE----DPQIPACSLGLKPNVQFQKLPHPSHPLVSTEAVLAAATSSSYSAGPPKA 127
            |..:||...:.|    :|:....:...:|..  ..||.|:.||....|:.|.:.|||..:|    
Human    46 CSTRDGDGDEEEYYGSEPRARGLAGDKEPRA--GPLPPPAPPLPPPGALDALSLSSSLDSG---- 104

  Fly   128 AATDSIATLRHCVDGATQCNNLNYESASNESMPSVGSLVCRICHNADNPEQLVSPCLCKGSLTYV 192
                    ||                     .|.     ||||.......:|:|||.|.||:...
Human   105 --------LR---------------------TPQ-----CRICFQGPEQGELLSPCRCDGSVRCT 135

  Fly   193 HVHCLECWISTSRCTTCELCQFQY-----NTEQTLRYTCLQ-----------------------S 229
            |..||..|||.....:||||.|:|     :|:..|::..:.                       |
Human   136 HQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASIS 200

  Fly   230 LRLWYSRAMSRRALQED-----CQ-MFSLLTLVAFGIIGTLLVGIQYYALHTHSWGLSKLW 284
            ..:|.|.:.|.:..::|     |. |:..:.:|..|:|  :..|...|.:......:::.|
Human   201 WLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLI--IHEGSSVYRIFKRWQAVNQQW 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 19/87 (22%)
RINGv 166..213 CDD:128983 20/46 (43%)
MARCHF9NP_612405.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..92 10/46 (22%)
RINGv 109..155 CDD:128983 19/50 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..301
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.