DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and AT1G50440

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001117462.1 Gene:AT1G50440 / 841466 AraportID:AT1G50440 Length:250 Species:Arabidopsis thaliana


Alignment Length:194 Identity:47/194 - (24%)
Similarity:74/194 - (38%) Gaps:57/194 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CRICHNADNPEQLVSPCLCKGSLTYVHVHCLECWIST------SRCTTCELCQFQYNTEQTLRYT 225
            ||||.:... |.|::||.|||:..:||..||:.|.||      |.||.|.               
plant    64 CRICLDVGG-EDLIAPCNCKGTQKHVHRSCLDNWRSTKEGFAFSHCTECR--------------- 112

  Fly   226 CLQSLRL------WYSRAMSRRALQEDCQ--MFSLLTLVAFGIIGTLLVGI------QYYALHTH 276
            ....||.      |:.|...:..:..|..  ..|:..:|||  :|.|:...      :.:....|
plant   113 AFFKLRANVPADRWWLRLRFQLLVARDHAFIFISVQMIVAF--LGLLVYKFYGEELREMFGYEEH 175

  Fly   277 SWGLSKLWTKS----WMLFFLFMTI----TVYFANIYMLIKSQLTPWYRWWQSARDIKLILENR 332
            .:|...|...:    .:|:..|:.|    .:...:.::|.|.:||..|           |:|:|
plant   176 PYGFYTLAVLAIVLVGLLYGFFIAIICGQKINERHYHVLAKQELTKEY-----------IVEDR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606
RINGv 166..213 CDD:128983 22/51 (43%)
AT1G50440NP_001117462.1 RING_CH-C4HC3_MARCH 64..112 CDD:319409 21/48 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.