DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and zgc:158785

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001074165.1 Gene:zgc:158785 / 791214 ZFINID:ZDB-GENE-070112-1712 Length:231 Species:Danio rerio


Alignment Length:227 Identity:67/227 - (29%)
Similarity:95/227 - (41%) Gaps:40/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DSIATLRHCVDGATQCNNLNYESASNESMP------SVGSLV-----CRICHNADNPEQLVSPCL 184
            ||...|....|...|.|. :.|| |.:.:|      .:.|::     |||||.......|:|||.
Zfish     5 DSANGLSSAPDSVLQVNP-DTES-STDPLPDPVSPNGIFSVIAEEPFCRICHEDSAAGDLLSPCE 67

  Fly   185 CKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQTLRYTCLQSLRLWY---SRAMSRRALQED 246
            |.|||..||..|||.|::.|..::||||.|||..|:..:     ....|.   |....||.|..|
Zfish    68 CAGSLAMVHRVCLEQWLTASGTSSCELCHFQYALERLPK-----PFTEWLSAPSMQQQRRTLCGD 127

  Fly   247 CQMFSLLTLVAFGIIGTLLV-GIQ--YYALHTHSWGLSKLWTKSWMLFFLFMTITVYFANIYMLI 308
            ...|..:|.:| .:.|.|.| |..  ||:....:.||..| |.:....:||.|:.....:|::  
Zfish   128 VICFLFITPLA-SLSGWLCVQGAMDLYYSNGMEAVGLIIL-TLTLFTIYLFWTVVSLRYHIHL-- 188

  Fly   309 KSQLTPWYRWWQSARDIKLILENRRPFPNPSR 340
                   :|.|.:...     ..|...|.|::
Zfish   189 -------FRTWNATNP-----SVRLQIPRPAK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 6/19 (32%)
RINGv 166..213 CDD:128983 23/51 (45%)
zgc:158785NP_001074165.1 RINGv 49..96 CDD:128983 23/46 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46065
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4119
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.