Sequence 1: | NP_611511.3 | Gene: | CG13442 / 37349 | FlyBaseID: | FBgn0034546 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001269734.1 | Gene: | MARCHF7 / 64844 | HGNCID: | 17393 | Length: | 704 | Species: | Homo sapiens |
Alignment Length: | 209 | Identity: | 47/209 - (22%) |
---|---|---|---|
Similarity: | 68/209 - (32%) | Gaps: | 79/209 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 LSDLKPETTLEMEIDEALSSSSADDTPPGMIVVETRISSWQKVKCYDKDGTTADAEDPQIPACSL 87
Fly 88 GLKPNVQFQKLPHPSHPLVSTEAVLAAATSSSYSAGPPKAAATDSIATLRHCVDGATQCNNLNYE 152
Fly 153 SASNESMPSVGSLVCRICH--NADNPEQLVSPCLCKGSLTYVHVHCLECWI--------STSRCT 207
Fly 208 TCELC--QFQYNTE 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13442 | NP_611511.3 | AmyAc_family | <36..>151 | CDD:298606 | 15/114 (13%) |
RINGv | 166..213 | CDD:128983 | 24/58 (41%) | ||
MARCHF7 | NP_001269734.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..126 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 157..279 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 294..313 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 319..343 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 361..425 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 444..473 | ||||
RING_Ubox | 552..610 | CDD:388418 | 24/57 (42%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 683..704 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5183 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |