DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and MARCHF7

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001269734.1 Gene:MARCHF7 / 64844 HGNCID:17393 Length:704 Species:Homo sapiens


Alignment Length:209 Identity:47/209 - (22%)
Similarity:68/209 - (32%) Gaps:79/209 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LSDLKPETTLEMEIDEALSSSSADDTPPGMIVVETRISSWQKVKCYDKDGTTADAEDPQIPACSL 87
            :|.:.|.:.....:..||.|:..|:.   ||.|:...|.|...........:|.:.||:      
Human   475 ISGILPGSLFRFAVPPALGSNLTDNV---MITVDIIPSGWNSADGKSDKTKSAPSRDPE------ 530

  Fly    88 GLKPNVQFQKLPHPSHPLVSTEAVLAAATSSSYSAGPPKAAATDSIATLRHCVDGATQCNNLNYE 152
                  :.||:.                                               .:|..|
Human   531 ------RLQKIK-----------------------------------------------ESLLLE 542

  Fly   153 SASNESMPSVGSLVCRICH--NADNPEQLVSPCLCKGSLTYVHVHCLECWI--------STSRCT 207
            .:..|.    |.| ||||.  .|.:...|:.||.|.|||.|||..|::.|:        |....|
Human   543 DSEEEE----GDL-CRICQMAAASSSNLLIEPCKCTGSLQYVHQDCMKKWLQAKINSGSSLEAVT 602

  Fly   208 TCELC--QFQYNTE 219
            |||||  :.:.|.|
Human   603 TCELCKEKLELNLE 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 15/114 (13%)
RINGv 166..213 CDD:128983 24/58 (41%)
MARCHF7NP_001269734.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..126
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..279
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..313
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..343
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..425
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..473
RING_Ubox 552..610 CDD:388418 24/57 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 683..704
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.