DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and marc-1

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001122964.1 Gene:marc-1 / 6418739 WormBaseID:WBGene00077696 Length:206 Species:Caenorhabditis elegans


Alignment Length:181 Identity:45/181 - (24%)
Similarity:81/181 - (44%) Gaps:29/181 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 NESMPSVGSLVCRIC--HNADNPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNT 218
            :||..|....:||||  |..|    :|.||.|.|::..||..||..|::.|...|||:|:.:| |
 Worm    41 SESTTSGSRRICRICQMHEGD----MVRPCDCAGTMGDVHEECLTKWVNMSNKKTCEICKSEY-T 100

  Fly   219 EQTLRYTCLQSLRLWYSRAMSRRALQEDCQMFSLLTLVAFGIIGTLLVGIQ----YY--ALHTHS 277
            ....::   :.::.|.....|..      .:|.:|.:|..|::.:.:|.:.    :|  .:..:.
 Worm   101 NSGAQF---KPIKQWSKPKCSLN------NIFHVLIIVLLGLLISYVVIVMEERCFYKRIIEKNM 156

  Fly   278 WGLSKLWTKSWMLFFLFMTITVYFANIYMLIKSQLTPWYRWWQSARDIKLI 328
            :.......:..::..|.:.|   ..|:|.||    ..:.|:.:|.|.|:.|
 Worm   157 YARPDDTGRICVIIILSLAI---LNNVYTLI----AQFIRYLKSQRQIRFI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606
RINGv 166..213 CDD:128983 20/48 (42%)
marc-1NP_001122964.1 RINGv 51..96 CDD:128983 20/48 (42%)
RING-CH finger (C4HC3-type) 52..95 CDD:319361 20/46 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46065
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.