DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and Marchf10

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_766156.2 Gene:Marchf10 / 632687 MGIID:2443469 Length:788 Species:Mus musculus


Alignment Length:437 Identity:82/437 - (18%)
Similarity:123/437 - (28%) Gaps:181/437 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TRSLSDLKPETTLEMEIDEALSSSSADDTPPGMIVVETRISSWQKVKCYDKDGTTAD---AEDPQ 81
            |..|.|.|.:..:::..|:..|..:.:|..    .|:.....||..  |....|:.|   :..|.
Mouse   393 TPVLGDAKSDGVIQVSADDVSSGGTVEDRS----AVQNHERDWQHY--YSGSRTSFDCLLSGRPT 451

  Fly    82 IPACSLG---------------------------------LKPNVQFQKLPHPSHPLVSTEAVLA 113
            .|..|:.                                 |:.|::| .:..|..|:.:...:.|
Mouse   452 APRSSMNPPYSAHGSLLHSALIDDIPANLSMSSILVPSSDLEENLRF-NVRRPLSPIRNRNPLAA 515

  Fly   114 AATSSSYSAGPPKAAATDSI------------------------ATLRHC-----VDGATQCN-- 147
            |...|..:.|..:.|:|..|                        .|.||.     :.|:.|.|  
Mouse   516 AEGRSDEAQGTQEMASTSHIQEPPLLADLPNPQSSVALGDSPSSPTRRHLQGHFYMPGSLQENIP 580

  Fly   148 ----------NLN-----------------------------YESASNESMPSVGSLVCRICHNA 173
                      |.|                             .||...|........:||||..|
Mouse   581 FTFFAVSDFANQNDNGTTVRVSGVMDEKATEIKADPEKLRKLQESLLEEDSEEEEGDLCRICQIA 645

  Fly   174 D----NPEQLVSPCLCKGSLTYVHVHCLECWIST--------SRCTTCELCQFQYNTEQTLRYTC 226
            .    ||  |:.||.|.|||.:||..||:.|:..        ....|||:|              
Mouse   646 GGSPANP--LLEPCGCVGSLQFVHQECLKKWLKVKITSGADLGTVKTCEMC-------------- 694

  Fly   227 LQSLRLWYSRAMSRRALQEDCQMFSLLTLVAFGIIGTLLVGIQYYALHTHSWGLSKLWTKSWMLF 291
                         ::.|..|...|::               .::|..|..|...|:|......|.
Mouse   695 -------------KQGLLVDLDDFNM---------------TEFYHKHQQSRAQSELMNSGLYLV 731

  Fly   292 FLFMTITVYFANIYMLIKSQLTPWYRWWQSARDIKLILENRRPFPNP 338
            .|.......||.:..|.       ||  :::|:   .|....|.|.|
Mouse   732 LLLHLYEQRFAELMALN-------YR--RASRE---RLSRNYPQPRP 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 32/220 (15%)
RINGv 166..213 CDD:128983 22/58 (38%)
Marchf10NP_766156.2 RING_CH-C4HC3_MARCH10 639..698 CDD:319727 23/87 (26%)
RING-CH finger (C4HC3-type) 639..694 CDD:319727 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.