DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and Marchf11

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001095298.1 Gene:Marchf11 / 499558 RGDID:1559945 Length:398 Species:Rattus norvegicus


Alignment Length:272 Identity:63/272 - (23%)
Similarity:104/272 - (38%) Gaps:70/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 EAVLAAATSSSYSAGPPKAAA--------------TDSIATLRHCVDGATQCNNLNYESASNESM 159
            |..|..|.:...|...|:|.|              |.|:.:.|....|.:......::...::. 
  Rat   101 EVKLPEAAAGKGSPAEPEAGACGEGERRGTGDQPETRSVCSSRSSSSGGSGDQRSGHQHQHHQP- 164

  Fly   160 PSVGSLVCRICHNADNPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYN-TEQTLR 223
                  :|:||.......:|::||.|.||:.|.|..||..|||.....|||||.::|: |...::
  Rat   165 ------ICKICFQGAEQGELLNPCRCDGSVRYTHQLCLLKWISERGSWTCELCCYRYHVTAIKMK 223

  Fly   224 YTCLQSLRLWYSRAMSRRALQEDCQMFSLLTLVAFGIIGTLLVGIQYYALHTHSWGLSKLWTKSW 288
            ..|     .|.|.:::   |.|..||.::       |:|:|.:......|...::....:|.:..
  Rat   224 QPC-----QWQSISIT---LVEKVQMIAV-------ILGSLFLIASVTWLLWSAFSPYAVWQRKD 273

  Fly   289 MLF------FLFMTITVY------FANIYMLIKSQLTPWYRW-----------WQSARDIKLILE 330
            :||      :.||.:...      .|.:|.:.|       ||           :..|.||:   |
  Rat   274 ILFQICYGMYGFMDLVCIGLIVHEGAAVYRVFK-------RWRAVNLHWDVLNYDKATDIE---E 328

  Fly   331 NRRPFPNPSRFL 342
            :.|...:.||.|
  Rat   329 SSRGESSTSRTL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 11/55 (20%)
RINGv 166..213 CDD:128983 20/46 (43%)
Marchf11NP_001095298.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..158 11/56 (20%)
RING_CH-C4HC3_MARCH4_like 165..215 CDD:319614 21/49 (43%)
YXXL motif 367..370
PDZ-binding 395..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.