DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and marchf3

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001007499.1 Gene:marchf3 / 493225 XenbaseID:XB-GENE-491983 Length:251 Species:Xenopus tropicalis


Alignment Length:267 Identity:68/267 - (25%)
Similarity:108/267 - (40%) Gaps:54/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VLAAATSSSYSAGPPKAAATDSIATLRH----------CVDG---ATQCNNLNYESASNESMPSV 162
            ||...|||:     |.....:..::|.:          ..||   :|....|..:|.::..|   
 Frog    12 VLPDCTSSA-----PSGKTVEDCSSLVNGQPQYVMQVSAKDGQLLSTVVRTLTTQSFNDRPM--- 68

  Fly   163 GSLVCRICHNADNPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQTLRYTCL 227
                |||||.....|.|:|||.|.|:|..:|..|||.|:|:|..:.||||.|:::.|:..|    
 Frog    69 ----CRICHEGSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFSVERKPR---- 125

  Fly   228 QSLRLWYSR---AMSRRALQEDCQMFSLLTLVAFGIIGTL----LVGIQYYALHTHSWGLSKLWT 285
             .|..|...   ...:|.|..|...|..:|.:| .|.|.|    .|...:::....:.||..| |
 Frog   126 -PLVEWLRNPGPQHEKRTLFGDMVCFLFITPLA-TISGWLCLRGAVDHLHFSSRLEAVGLIAL-T 187

  Fly   286 KSWMLFFLFMTITV--YFANIYMLIKSQLTPWYRWWQSARDIKLILENRRPFPNPSRF---LRSF 345
            .:....:||.|:..  |...:|          ..|.::.:.:.|::......|:..:.   |.||
 Frog   188 VALFTIYLFWTLVSFRYHCRLY----------NEWRRTNQRVILVIPKSANLPSAQQSLLGLHSF 242

  Fly   346 QLETVST 352
            :..:..|
 Frog   243 KRNSKET 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 11/52 (21%)
RINGv 166..213 CDD:128983 23/46 (50%)
marchf3NP_001007499.1 RING_CH-C4HC3_MARCH2_like 68..118 CDD:319613 26/56 (46%)
RING-CH finger (C4HC3-type) 69..114 CDD:319613 22/44 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10135
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46065
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4119
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.