DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and MARCHF11

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001096032.1 Gene:MARCHF11 / 441061 HGNCID:33609 Length:402 Species:Homo sapiens


Alignment Length:299 Identity:70/299 - (23%)
Similarity:111/299 - (37%) Gaps:88/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 KLPHPSHPLVSTEAVLAAATSSSYSAGP---PKAAA--------------------------TDS 132
            :||.|..||......:|||..|  ..||   |:|||                          |.|
Human    81 ELPPPPLPLQPAGQEVAAAGDS--GEGPRRLPEAAAAKGGPGESEAGAGGERERRGAGDQPETRS 143

  Fly   133 IATLRHCVDGATQCNNLNYESASNESMPSVGSLVCRICHNADNPEQLVSPCLCKGSLTYVHVHCL 197
            :.:.|....|... ....::...::.       :|:||.......:|::||.|.||:.|.|..||
Human   144 VCSSRSSSSGGGD-QRAGH
QHQHHQP-------ICKICFQGAEQGELLNPCRCDGSVRYTHQLCL 200

  Fly   198 ECWISTSRCTTCELCQFQYNT-EQTLRYTCLQSLRLWYSRAMSRRALQEDCQMFSLLTLVAFGII 261
            ..|||.....|||||.::|:. ...::..|     .|.|.:::   |.|..||.::       |:
Human   201 LKWISERGSWTCELCCYRYHVIAIKMKQPC-----QWQSISIT---LVEKVQMIAV-------IL 250

  Fly   262 GTLLVGIQYYALHTHSWGLSKLWTKSWMLF------FLFMTITVY------FANIYMLIKSQLTP 314
            |:|.:......|...::....:|.:..:||      :.||.:...      .|.:|.:.|     
Human   251 GSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVHEGAAVYRVFK----- 310

  Fly   315 WYRW-----------WQSARDIKLILENRRPFPNPSRFL 342
              ||           :..|.||:   |:.|...:.||.|
Human   311 --RWRAVNLHWDVLNYDKATDIE---ESSRGESSTSRTL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 19/82 (23%)
RINGv 166..213 CDD:128983 20/46 (43%)
MARCHF11NP_001096032.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..161 19/82 (23%)
RINGv 169..215 CDD:128983 19/45 (42%)
YXXL motif 371..374
PDZ-binding 399..402
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.