DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and CG4080

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:112/243 - (46%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 NLNYESASNESMPSVGSLVCRICHNADNPEQ-LVSPCLCKGSLTYVHVHCLECWISTSRCTTCEL 211
            |:.:.|.|:::..:.|. :|||||...:|:. |::||.|.|||.|||..||:.|::.|...:|||
  Fly    25 NVRFGSGSSQASQNSGD-ICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCEL 88

  Fly   212 CQFQYNTEQTLRYTCLQSLRLWYSRAMS---RRALQEDCQMFSLLTLVAFGIIGTLLVGIQYYAL 273
            |:|.:     :.:|.::....|.|..:|   ||.|   |.........|..:|.:|.|.|:..|.
  Fly    89 CKFPF-----IMHTKIKPFNEWRSLDISGIERRRL---CYSVLFHCAAALCVIWSLCVLIERAAD 145

  Fly   274 HTH----SWGLSKLWTKSWMLFFLFMTITVYFANIYMLIKSQLTPWYRWWQSARDIKLILENRRP 334
            ...    .|   ..|||   |..:.:.:|.....:|:..|:.|...:||  .||:..|:::|.  
  Fly   146 DVQRGLIDW---PFWTK---LAVVTVGLTGGIVFMYIQCKAYLHLCHRW--KARNRILLIQNA-- 200

  Fly   335 FPNPSRFLRSFQLETVSTTASMYTHHDQQEAPVP---SSSPVIVITSS 379
               |.:      :..|:..:.:..||.....|:.   |:|..:.|.:|
  Fly   201 ---PEK------IHPVAPPSPVAAHHQHFSEPLAHAGSTSGAVEINAS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 1/2 (50%)
RINGv 166..213 CDD:128983 23/47 (49%)
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 23/47 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1133
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
43.810

Return to query results.
Submit another query.