DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and CG1317

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster


Alignment Length:286 Identity:57/286 - (19%)
Similarity:97/286 - (33%) Gaps:76/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 VCRICHNADNPEQ-LVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQT-------- 221
            :||:|.....|:: |..||:|.||:.|:|..||..|:..|....||||.:.::.:..        
  Fly     9 ICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPIYAPDMPRV 73

  Fly   222 ---------LRYTCLQSLRLWYSRAMSRRALQEDCQMFSLLTLVAFGIIGTLLVGIQYYALHTHS 277
                     |....|:..|.|..              ::|:.|..||::.........|.....|
  Fly    74 LPIKDVLVGLMSAVLEGARCWLH--------------YTLVGLAWFGVVPLSAYRTYRYLFRASS 124

  Fly   278 WGLSKLWTKSWMLFFLFMTITVYFANIYMLIKSQLT----PWYRW---------WQSARDIKLIL 329
            :.:  :.|..:.:|.:....:..|...:::..:.|:    .|.|.         |....|..|..
  Fly   125 FDM--ILTLPFDIFSVENLASDAFRGCFVVTCTLLSFIGLVWLREQILHGGGPDWLERDDAPLQA 187

  Fly   330 ENRRPFPNPSRFLRSFQLETVSTTASMYTHHDQQEAPVPSSSPVIVITSSEEETEDKLAHKWGTR 394
            ....|.|:|:       .|..........:.|..|||.|:.:     ...:.:.:|         
  Fly   188 AAANPAPDPA-------AEAAPQPQDDNNNADDNEAPAPADN-----DGQDAQAQD--------- 231

  Fly   395 LDSEVLAAVVAATVESIADASARESD 420
                  ||..||.  .:.||.|.|.:
  Fly   232 ------AAPAAAA--PVVDADADEQN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606
RINGv 166..213 CDD:128983 19/47 (40%)
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 18/46 (39%)
DotA_TraY <737..913 CDD:275142
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.