DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and Marchf4

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001038998.1 Gene:Marchf4 / 381270 MGIID:2683550 Length:409 Species:Mus musculus


Alignment Length:300 Identity:71/300 - (23%)
Similarity:113/300 - (37%) Gaps:79/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SAGPPKAAATDSIATLRHCVDGATQCNNLNYESASNESMPSVGSLVCRICHNADNPEQLVSPCLC 185
            :.||| |:...|.::...|.:....|.:|.....|....|     :||||.......:|:|||.|
Mouse   122 ATGPP-ASLLSSA
SSDEFCKEKTEDCYSLGSSLDSGMRTP-----LCRICFQGPEQGELLSPCRC 180

  Fly   186 KGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQTLRYTCLQSLRLWYSRAMSRRALQEDCQMF 250
            .||:...|..||..|||...|.:||||.::|:.........||    |  :|:|...:::     
Mouse   181 DGSVKCTHQPCLIKWISERGCWSCELCYYKYHVIAISTKNPLQ----W--QAISLTVIEK----- 234

  Fly   251 SLLTLVAFGIIGTLLVGIQYYALHTHSWGL------SKLWTKSWMLF------FLFMTITVY--- 300
               ..:|..|:|:|      :.:.:.||.:      |..|.:..:||      :.||.:...   
Mouse   235 ---VQIAAAILGSL------FLIASISWLIWSTFSPSAKWQRQDLLFQICYGMYGFMDVVCIGLI 290

  Fly   301 ---FANIYMLIKSQLTPWYRWWQSARDIKLILENRRPFPNPSRFLRSFQLETVSTTASMYTHHDQ 362
               ..::|.:.|.        ||:......:|          .:.::..||            ||
Mouse   291 IHEGPSVYRIFKR--------WQAVNQQWKVL----------NYDKTKDLE------------DQ 325

  Fly   363 QEAP----VPSSSPVIVITSSEEETEDKLAHKWG-TRLDS 397
            :...    ..|||....:.|:|||.....|.:.| ||..|
Mouse   326 KSGGRTNLQTSSSAQANLPSAEEEAASPPAREEGPTRAAS 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 8/29 (28%)
RINGv 166..213 CDD:128983 21/46 (46%)
Marchf4NP_001038998.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..133 4/11 (36%)
RING_CH-C4HC3_MARCH4_9 161..211 CDD:319725 22/49 (45%)
RING-CH finger (C4HC3-type) 162..207 CDD:319725 20/44 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..372 14/54 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.