DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and Marchf3

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001007760.1 Gene:Marchf3 / 364878 RGDID:1359308 Length:253 Species:Rattus norvegicus


Alignment Length:246 Identity:68/246 - (27%)
Similarity:97/246 - (39%) Gaps:60/246 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VLAAATSSSYSAGPPKAAATDSIATLRHC---VDG----------------ATQCNNLNYESASN 156
            ||...|||          |...:.|:..|   |:|                :|....|..:|..|
  Rat    12 VLPDCTSS----------AAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFN 66

  Fly   157 ESMPSVGSLVCRICHNADNPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQT 221
            :..      :|||||...:.|.|:|||.|.|:|..:|..|||.|:|:|..:.||||.|::..|:.
  Rat    67 DRP------MCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERK 125

  Fly   222 LRYTCLQSLRLWYSR---AMSRRALQEDCQMFSLLTLVAFGIIGTL----LVGIQYYALHTHSWG 279
            .|     .|..|...   ...:|.|..|...|..:|.:| .|.|.|    .|...:::....:.|
  Rat   126 PR-----PLVEWLRNPGPQHEKRTLFGDMVCFLFITPLA-TISGWLCLRGAVDHLHFSSRLEAVG 184

  Fly   280 LSKLWTKSWMLFFLFMTITV--YFANIYMLIKSQLTPWYRWWQSARDIKLI 328
            |..| |.:....:||.|:..  |...:|       ..|.|  .:.|.|.||
  Rat   185 LIAL-TVALFTIYLFWTLVSFRYHCRLY-------NEWRR--TNQRVILLI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 12/58 (21%)
RINGv 166..213 CDD:128983 23/46 (50%)
Marchf3NP_001007760.1 RING_CH-C4HC3_MARCH2_like 70..120 CDD:319613 25/49 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10078
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46065
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.