DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and Marchf2

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_038935345.1 Gene:Marchf2 / 362849 RGDID:1306395 Length:276 Species:Rattus norvegicus


Alignment Length:288 Identity:71/288 - (24%)
Similarity:105/288 - (36%) Gaps:91/288 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GPPKAAATDS------IATLRHCVDGATQCNNLNYESASNESMPSVGSLVCRICHNADNPEQLVS 181
            |||:..|..:      ::|:...:|..:.|.                  .|||||...|.|.|:|
  Rat    32 GPPQYVAQVTSRDGRLLSTVIRALDTPSDCP------------------FCRICHEGANGENLLS 78

  Fly   182 PCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQTLRYTCLQSLRLWY---SRAMSRRAL 243
            ||.|.|:|..||..|||.|:|:|..:.||||..::..|:..|     .|..|.   .....:|.|
  Rat    79 PCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPR-----PLTEWLKDPGPRTEKRTL 138

  Fly   244 QEDCQMFSLLTLVAFGIIGTL-LVGIQ-YYALHT--HSWGLSKLWTKSWMLFFLFMTITVYFANI 304
            ..|...|..:|.:| .|.|.| |.|.| :..||:  .:.||              :.:|:....|
  Rat   139 CCDMVCFVFITPLA-AISGWLCLRGAQDHLRLHSRLEAVGL--------------IALTIALFTI 188

  Fly   305 YMLIKSQLTPWYRWWQSARDIKLILENRRPFPNPSRFLRSFQLETVSTTASMYTHHDQQEAPV-- 367
            |:|           |                        :.:||.....|.:|.....:.||.  
  Rat   189 YVL-----------W------------------------TLRLEHFEVEACLYLPTHCRTAPAGL 218

  Fly   368 -PSSSPVIVITSSEEETEDKLAHKWGTR 394
             |...|.::  ..||:..:..|...|:|
  Rat   219 FPIPLPAVL--GMEEDQSESPAEDPGSR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 7/33 (21%)
RINGv 166..213 CDD:128983 25/46 (54%)
Marchf2XP_038935345.1 RING_CH-C4HC3_MARCH2 62..113 CDD:319722 26/68 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10078
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46065
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.