DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and Marchf8

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_008761465.1 Gene:Marchf8 / 312656 RGDID:1309339 Length:568 Species:Rattus norvegicus


Alignment Length:257 Identity:67/257 - (26%)
Similarity:98/257 - (38%) Gaps:66/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 HPLVSTEAVLAAATSSSYSAGPPKAAATD----------SIATLRHCV----------DGATQCN 147
            |.|.:..:.|..|.|||:.||.....:.:          |.|.|::.|          |....|.
  Rat   274 HELENHASRLHTAKSSSWLAGSMGFCSDEMGDDDVFEDASSAKLKNRVLRAPLCSVEKDSDLDCP 338

  Fly   148 NLNYESASNESMPSVGSLVCRICH-NADNPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCEL 211
            ::..|..:..|..|.....||||| ..|:...|::||.|.|||.:||..||:.||.:|....|||
  Rat   339 SVLSEKCTPISPVSTSGDACRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCEL 403

  Fly   212 CQFQYNTEQTLRYTCLQSLRLWYSRAMS---RRALQEDCQMFSLLTLVAFGIIGTLLVGIQYYAL 273
            |::::..|     |.|:.||.|....|:   ||         .::..|.|.:|....|....|.|
  Rat   404 CKYEFIME-----TKLKPLRKWEKLQMTASERR---------KIMCSVTFHVIAITCVVWSLYVL 454

  Fly   274 HTHS--------------WGLSKLWTKSWMLFFLFMTITVYFAN----IYMLIKSQLTPWYR 317
            ...:              |   ..|||       .:.:.:.|..    :|:..|..|..|.|
  Rat   455 IDRTAEEIKQGQVTGILEW---PFWTK-------LVVVAIGFTGGLLFMYVQCKVYLQLWKR 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 15/67 (22%)
RINGv 166..213 CDD:128983 23/47 (49%)
Marchf8XP_008761465.1 RING_CH-C4HC3_MARCH1_like 357..408 CDD:319612 24/50 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.