DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and Marchf7

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_038960759.1 Gene:Marchf7 / 311059 RGDID:1308993 Length:713 Species:Rattus norvegicus


Alignment Length:209 Identity:46/209 - (22%)
Similarity:68/209 - (32%) Gaps:78/209 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LSDLKPETTLEMEIDEALSSSSADDTPPGMIVVETRISSWQKVKCYDKDGTTADAEDPQIPACSL 87
            ::.:.|.:.....:..||.|:..|:.   .|.|:...|.|.......:...:|.:.||:      
  Rat   489 IAGILPGSLFRFAVPPALGSNLTDNV---TITVDIIPSGWSSADGKSEKAKSAPSRDPE------ 544

  Fly    88 GLKPNVQFQKLPHPSHPLVSTEAVLAAATSSSYSAGPPKAAATDSIATLRHCVDGATQCNNLNYE 152
                  :.||:.                                               .:|..|
  Rat   545 ------KLQKIK-----------------------------------------------ESLLLE 556

  Fly   153 SASNESMPSVGSLVCRICH--NADNPEQLVSPCLCKGSLTYVHVHCLECWI--------STSRCT 207
            .:..|   ..|.| ||||.  .|.:...|:.||.|.|||.|||..|::.|:        |....|
  Rat   557 DSDEE---EEGDL-CRICQMAAASSSNLLIEPCKCTGSLQYVHQECMKKWLQAKINSGSSLEAVT 617

  Fly   208 TCELC--QFQYNTE 219
            |||||  :.|.|.|
  Rat   618 TCELCKEKLQLNLE 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 14/114 (12%)
RINGv 166..213 CDD:128983 24/58 (41%)
Marchf7XP_038960759.1 RING_CH-C4HC3_MARCH7 564..625 CDD:319726 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.