DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and Marchf2

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_663461.2 Gene:Marchf2 / 224703 MGIID:1925915 Length:287 Species:Mus musculus


Alignment Length:215 Identity:60/215 - (27%)
Similarity:90/215 - (41%) Gaps:45/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GPPKAAATDS------IATLRHCVDGATQCNNLNYESASNESMPSVGSLVCRICHNADNPEQLVS 181
            |||:..|..:      ::|:...:|..:.|.                  .|||||...|.|.|:|
Mouse    32 GPPQYVAQVTSRDGRLLSTVIRALDSQSDCP------------------FCRICHEGANGENLLS 78

  Fly   182 PCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQTLRYTCLQSLRLWY---SRAMSRRAL 243
            ||.|.|:|..||..|||.|:|:|..:.||||..::..|:..|     .|..|.   .....:|.|
Mouse    79 PCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPR-----PLTEWLKDPGPRTEKRTL 138

  Fly   244 QEDCQMFSLLTLVAFGIIGTL-LVGIQ-YYALHT--HSWGLSKLWTKSWMLFFLFMTITV-YFAN 303
            ..|...|..:|.:| .|.|.| |.|.| :..||:  .:.||..|....:.::.|:..::. |...
Mouse   139 CCDMVCFVFITPLA-AISGWLCLRGAQDHLRLHSRLEAVGLIALTIALFTIYVLWTLVSFRYHCQ 202

  Fly   304 IYMLIKSQLTPWYRWWQSAR 323
            :|       :.|.:..|..|
Mouse   203 LY-------SEWRKTNQKVR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 7/33 (21%)
RINGv 166..213 CDD:128983 25/46 (54%)
Marchf2NP_663461.2 RINGv 63..110 CDD:128983 25/46 (54%)
Vpu 173..>224 CDD:109608 9/50 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10299
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46065
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4119
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.