DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and MARCHF8

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001269795.1 Gene:MARCHF8 / 220972 HGNCID:23356 Length:573 Species:Homo sapiens


Alignment Length:299 Identity:79/299 - (26%)
Similarity:115/299 - (38%) Gaps:81/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PGMIVVETRISSWQKVKCYDKDGTTADAEDPQIPACSLGLKPNVQFQKLPHPSHPLVSTEAVLAA 114
            ||:::.|            ..|| .|.:...|:......|...:....| |..|.|.|..|.|..
Human   239 PGLLLEE------------KADG-EATSRSRQLLQYLFSLSHGLSASSL-HRFHELESCAARLHT 289

  Fly   115 ATSSSYSAGPPKAAATD----------SIATLRHCVDGATQC-----NNLNYESASNESMPSVGS 164
            |.|||..||.....:.:          :.|.|:..|..|..|     ::|:..|..:|.:|.:..
Human   290 AKSSSGLAGSMGFCSDEMGDDDVFEDSTSAKLKSRVLRAPLCSTEKDSDLDCPSPFSEKLPPISP 354

  Fly   165 L-----VCRICH-NADNPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQTLR 223
            :     |||||| ..|:...|::||.|.|||.:||..||:.||.:|....||||::::..|    
Human   355 VSTSGDVCRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIME---- 415

  Fly   224 YTCLQSLRLWYSRAMSRRALQEDCQMFS-----LLTLVAFGIIGTLLVGIQYYALHTHS------ 277
             |.|:.||.|           |..||.|     ::..|.|.:|....|....|.|...:      
Human   416 -TKLKPLRKW-----------EKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQ 468

  Fly   278 --------WGLSKLWTK--------SWMLFFLFMTITVY 300
                    |   ..|||        :..|.|:::...||
Human   469 GQATGILEW---PFWTKLVVVAIGFTGGLLFMYVQCKVY 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 27/115 (23%)
RINGv 166..213 CDD:128983 24/47 (51%)
MARCHF8NP_001269795.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..72
RINGv 361..409 CDD:128983 24/47 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.