DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and Marchf9

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001028434.1 Gene:Marchf9 / 216438 MGIID:2446144 Length:348 Species:Mus musculus


Alignment Length:197 Identity:48/197 - (24%)
Similarity:74/197 - (37%) Gaps:47/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 AGPPKAAATDSIATLRHCVDGATQCNNLNYESASNESMPSVGSLVCRICHNADNPEQLVSPCLCK 186
            ||||...|.....      .||....:|:....|....|.     ||||.......:|:|||.|.
Mouse    76 AGPPPPPAPPPPP------PGALDALS
LSSSLDSGLRTPQ-----CRICFQGPEQGELLSPCRCD 129

  Fly   187 GSLTYVHVHCLECWISTSRCTTCELCQFQY-----NTEQTLRYTCLQ------------------ 228
            ||:...|..||..|||.....:||||.|:|     :|:..|::..:.                  
Mouse   130 GSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLF 194

  Fly   229 -----SLRLWYSRAMSRRALQED-----CQ-MFSLLTLVAFGIIGTLLVGIQYYALHTHSWGLSK 282
                 |..:|.|.:.|.:..::|     |. |:..:.:|..|:|  :..|...|.:......:::
Mouse   195 LVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLI--VHEGSSVYRIFKRWQAVNQ 257

  Fly   283 LW 284
            .|
Mouse   258 QW 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 8/28 (29%)
RINGv 166..213 CDD:128983 20/46 (43%)
Marchf9NP_001028434.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..96 7/25 (28%)
RINGv 109..155 CDD:128983 19/50 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.