Sequence 1: | NP_611511.3 | Gene: | CG13442 / 37349 | FlyBaseID: | FBgn0034546 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001028434.1 | Gene: | Marchf9 / 216438 | MGIID: | 2446144 | Length: | 348 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 48/197 - (24%) |
---|---|---|---|
Similarity: | 74/197 - (37%) | Gaps: | 47/197 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 AGPPKAAATDSIATLRHCVDGATQCNNLNYESASNESMPSVGSLVCRICHNADNPEQLVSPCLCK 186
Fly 187 GSLTYVHVHCLECWISTSRCTTCELCQFQY-----NTEQTLRYTCLQ------------------ 228
Fly 229 -----SLRLWYSRAMSRRALQED-----CQ-MFSLLTLVAFGIIGTLLVGIQYYALHTHSWGLSK 282
Fly 283 LW 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13442 | NP_611511.3 | AmyAc_family | <36..>151 | CDD:298606 | 8/28 (29%) |
RINGv | 166..213 | CDD:128983 | 20/46 (43%) | ||
Marchf9 | NP_001028434.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 48..96 | 7/25 (28%) | |
RINGv | 109..155 | CDD:128983 | 19/50 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 272..304 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 328..348 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5183 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |