DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and marc-2

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_496302.2 Gene:marc-2 / 183961 WormBaseID:WBGene00008433 Length:206 Species:Caenorhabditis elegans


Alignment Length:160 Identity:41/160 - (25%)
Similarity:70/160 - (43%) Gaps:26/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 NYESASNESMPSVGSLVCRICHNAD-NPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQ 213
            |.|:..:....|..:::||||.:.| :.:.|:.||.|.|::.|||..|||.|:.|:....|.:||
 Worm     8 NLETIRSPKEVSTKTVICRICFDNDTSSDSLIKPCSCSGTVAYVHNGCLEQWVRTTSNIQCTICQ 72

  Fly   214 FQYNTEQTLRYTCLQSLRLWYSRAMSRRALQ--ED-----CQMFSLLTLVAFGIIGTLLVG---- 267
            ..:.....       .|:.|....:.|...:  ||     |.:..::.::.|..:| |..|    
 Worm    73 DMFELIPA-------GLKDWNKITLPRPLSEQLEDYMEFGCTLAWVVYMLRFAYVG-LRYGSRSM 129

  Fly   268 IQYYALHTHSWGLSKLWTKSWMLF---FLF 294
            |:...:...:..:...|   ||.|   ||:
 Worm   130 IENVDMAIGTGMMRSFW---WMTFWFNFLY 156

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity