DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and marc-5

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_496624.3 Gene:marc-5 / 174876 WormBaseID:WBGene00013273 Length:601 Species:Caenorhabditis elegans


Alignment Length:316 Identity:79/316 - (25%)
Similarity:121/316 - (38%) Gaps:98/316 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITSNAGDHR-LNLTRSLSDLKPETTLEMEIDEALSSSSADDTPPGMIVVETRISSWQKV------ 65
            :|:|.|... :.||:|.|                .:|..|.|....:...||..|.:||      
 Worm   177 VTTNGGGGTVIGLTKSHS----------------LNSFEDSTASVFVSTTTRCHSGRKVHQLKNP 225

  Fly    66 -----------KCYDKDGTTADA---------EDPQ----IPACSL--GLKPNV-QFQKLPHPSH 103
                       :.::|..:..||         |:|.    :.|..|  ||:.:| |...|.|  |
 Worm   226 SRVTVTQEEENRNFEKKKSRIDAIGSLLSLHDEEPTSNSGMDAMDLEKGLEKDVSQLGILCH--H 288

  Fly   104 PLVSTEAVLAAATSSSYSAGPPKAAATDSIATLRHCVDGATQCNNLNYESASNESMPSVGSLVCR 168
              .||..:....|.....:  |.|::..|:|.                ...|||.:       ||
 Worm   289 --CSTTDLTCPKTQKELPS--PSASSVYSLAR----------------SDMSNEPL-------CR 326

  Fly   169 ICH---NADNPEQLVSPCLCKGSLTYVHVHCLECWISTS-----RCTTCELCQFQYNTEQTLRYT 225
            |||   ..|:.:.|:|||.|.|||.||||.||..|:..|     |...||||.::|...:.|:| 
 Worm   327 ICHCCWPPDSNDPLISPCRCSGSLQYVHVSCLMHWLDISSRKLHRPAICELCLYKYRRRRVLKY- 390

  Fly   226 CLQSLRLWYSRAMSRRALQEDCQMFSLLTLVAFGIIGTLLVGIQYYALHTHSWGLS 281
              :.::|       .:..|.|.:.::|..:....:|.:....:..:.|. .|:|||
 Worm   391 --REMKL-------PQCAQADIRFYTLFVVAIVLMILSAFSTVVCFQLE-KSYGLS 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 29/147 (20%)
RINGv 166..213 CDD:128983 26/54 (48%)
marc-5NP_496624.3 RING_CH-C4HC3_MARCH 325..378 CDD:319409 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4782
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.