DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and MARCHF10

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_005257152.2 Gene:MARCHF10 / 162333 HGNCID:26655 Length:863 Species:Homo sapiens


Alignment Length:246 Identity:55/246 - (22%)
Similarity:80/246 - (32%) Gaps:94/246 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 ESASNESMPSVGSLVCRICHNA----DNPEQLVSPCLCKGSLTYVHVHCLECWIST--------S 204
            ||...|.....|.| ||||..|    .||  |:.||.|.|||.:||..||:.|:..        .
Human   683 ESLLEEDSEEEGDL-CRICQIAGGSPSNP--LLEPCGCVGSLQFVHQECLKKWLKVKITSGADLG 744

  Fly   205 RCTTCELCQFQYNTEQTLRYTCLQSLRLWYSRAMSRRALQEDCQMFSLLTLVAFGIIGTLLVGIQ 269
            ...|||:|                           ::.|..|...|::               |:
Human   745 AVKTCEMC---------------------------KQGLLVDLGDFNM---------------IE 767

  Fly   270 YYALHTHSWGLSKLWTKSWMLFFLFMTITVYFANIYMLIKSQLTPWYRWWQSARDIKLILENRRP 334
            :|..|..|...::|......|..|.......||.:..|..:|                 :|..| 
Human   768 FYQKHQQSQAQNELMNSGLYLVLLLHLYEQRFAELMRLNHNQ-----------------VERER- 814

  Fly   335 FPNPSRFLRSFQLETVSTTASMYTHHDQQEA-------PVPSSSPVIVITS 378
                   :||:::|  ...|.:......:||       |:|   |.::.||
Human   815 -------IRSWEME--MKAAFLKARSSSKEANCGARRRPLP---PALLSTS 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606
RINGv 166..213 CDD:128983 22/58 (38%)
MARCHF10XP_005257152.2 RINGv 697..753 CDD:128983 23/84 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.