DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and MARCHF3

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_011541430.1 Gene:MARCHF3 / 115123 HGNCID:28728 Length:305 Species:Homo sapiens


Alignment Length:118 Identity:29/118 - (24%)
Similarity:47/118 - (39%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AAATSSSYSAGPPKAAATDSIATLRHCVDGATQCNN--LNYESASNESMPSVGSLVCRICHNADN 175
            ||...:|:|.|  :|||.:|         .|..|:.  |......:|.....|.:||.:   ...
Human   158 AAVCHASFSQG--RAAAVNS---------SADSCHPEWLRNPGPQHEKRTLFGDMVCFL---FIT 208

  Fly   176 PEQLVSPCLC-KGSLTYVHVHC-LECWISTSRCTTCELCQFQYNTEQTLRYTC 226
            |...:|..|| :|::.::|... ||. :.....|......:.:.|..:.||.|
Human   209 PLATISGWLCLRGAVDHLHFSSRLEA-VGLIALTVALFTIYLFWTLVSFRYHC 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 12/39 (31%)
RINGv 166..213 CDD:128983 11/48 (23%)
MARCHF3XP_011541430.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10485
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5684
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46065
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4119
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.