DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and MARCHF6

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_005876.2 Gene:MARCHF6 / 10299 HGNCID:30550 Length:910 Species:Homo sapiens


Alignment Length:291 Identity:70/291 - (24%)
Similarity:111/291 - (38%) Gaps:89/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 VCRICHNADNPEQ-LVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQTLRYTCLQS 229
            :||:|.:...||: |..||:|.||:.::|..||..|:..||...||||:.::      .:|.:  
Human     8 ICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRF------AFTPI-- 64

  Fly   230 LRLWYSRAM-SRRALQEDCQMFSLL--------------TLVAFGIIGTL-LVGIQYY-ALHTHS 277
                ||..| ||..:|:   :|:.|              |||||..:|.: |...:.| .|.|.|
Human    65 ----YSPDMPSRLPIQD---IFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFTGS 122

  Fly   278 WG------LSKLWTKSWM------LFFLFMTITVYFANIYMLIKSQLTPWYRWWQSARDIKLILE 330
            ..      |..|.|::.:      .|.:..|:..:.:.:          |.|        :.|:.
Human   123 VSSLLTLPLDMLSTENLLADCLQGCFVVTCTLCAFISLV----------WLR--------EQIVH 169

  Fly   331 NRRPFPNPSRFLRSFQLETVSTTASMYTHHDQQEAPVPSSSPVIVITSSEEETEDKLAHKWGTRL 395
            ...|          ..||..:...:...|| |.|||...:       .:|....|:.|:..... 
Human   170 GGAP----------IWLEHAAPPFNAAGHH-QNEAPAGGN-------GAENVAADQPANPPAEN- 215

  Fly   396 DSEVLAAVVAATVESIAD-ASARESDKQDED 425
                  |||....::..| |...|.|.::||
Human   216 ------AVVGENPDAQDDQAEEEEEDNEEED 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606
RINGv 166..213 CDD:128983 20/47 (43%)
MARCHF6NP_005876.2 RING_CH-C4HC3_MARCH6 8..57 CDD:319616 21/48 (44%)
RING-CH finger (C4HC3-type) 9..55 CDD:319616 19/45 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..256 18/71 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.