DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and marchf11

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_002933170.1 Gene:marchf11 / 100487933 XenbaseID:XB-GENE-982895 Length:287 Species:Xenopus tropicalis


Alignment Length:284 Identity:64/284 - (22%)
Similarity:106/284 - (37%) Gaps:88/284 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SAGPPKAAATDSIATLRHCVDGATQCNNLNYESASNESMPSVGSLVCRICHNADNPEQLVSPCLC 185
            |...|.|...:......|   |.|:.::.:.:|....|.|:     |:||.......:|::||.|
 Frog    16 SVDKPNAVVEEGAGAAIH---GGTRTDSDSVQSNDTPSPPT-----CKICFQGPEQGELLNPCRC 72

  Fly   186 KGSLTYVHVHCLECWISTSRCTTCELCQFQYNT-----EQTLRYTCLQSLRLWYSRAMSRRALQE 245
            .||:.|.|..||..|||.....|||||.::|..     ::..::.|:..            .|.|
 Frog    73 DGSVRYTHQLCLLKWISERGSWTCELCCYRYQVIAIRMKRPCQWQCITV------------TLVE 125

  Fly   246 DCQMFSLLTLVAFGIIGTLLVGIQYYALHTHSWGL------SKLWTKSWMLF------FLFMTIT 298
            ..||.::       |:|:|      :.:.:.:|.|      ..:|.:..:||      :.||.:.
 Frog   126 KVQMIAV-------ILGSL------FLISSVTWLLWSAFSPQAVWQRKDILFQICYGMYGFMDLV 177

  Fly   299 VY------FANIYMLIKSQLTPWYRW-----------WQSARDIKLILENRRPFPNPSRF----L 342
            ..      .|.:|.:.|       ||           :..|.||:   |:....|:.||.    |
 Frog   178 CIGLIVHEGAAVYTVFK-------RWRAVNLDWDVLNYDKATDIE---ESSNAVPSTSRTLWLPL 232

  Fly   343 RSFQLETVSTTASMYTHHDQQEAP 366
            .:|:..|:       .|..|..:|
 Frog   233 TAFRSRTL-------VHPTQLSSP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 6/29 (21%)
RINGv 166..213 CDD:128983 20/46 (43%)
marchf11XP_002933170.1 RING_Ubox 54..103 CDD:388418 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.