DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13442 and march9

DIOPT Version :9

Sequence 1:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_001339845.1 Gene:march9 / 100003493 ZFINID:ZDB-GENE-081031-71 Length:342 Species:Danio rerio


Alignment Length:152 Identity:38/152 - (25%)
Similarity:65/152 - (42%) Gaps:36/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CRICHNADNPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQY-----NTEQTLRY-- 224
            ||||.......:|:|||.|.||:...|..||..|||.....:||||.|:|     :|:..|::  
Zfish   106 CRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQA 170

  Fly   225 ---TCLQSLRL------------------WYSRAMSRRALQED-----CQ-MFSLLTLVAFGIIG 262
               |.::.:::                  |.|.:.|.:..::|     |. |:..:.:|..|:| 
Zfish   171 ISLTVIEKVQIAAIILGSLFLIASISWLVWSSLSPSAKWQRQDLLFQICYGMYGFMDIVCIGLI- 234

  Fly   263 TLLVGIQYYALHTHSWGLSKLW 284
             :..|...|.:......:::.|
Zfish   235 -IHEGSSVYRIFKRWQAVNQQW 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606
RINGv 166..213 CDD:128983 20/45 (44%)
march9XP_001339845.1 RINGv 105..151 CDD:128983 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.