DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr98d

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster


Alignment Length:394 Identity:94/394 - (23%)
Similarity:153/394 - (38%) Gaps:79/394 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RRSTFRISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDIRERLAKADNLVLSISALELLMSTLVF 99
            ||....:.:|..:.|:|:.:...|    ..:::..::||.:..|:..:.|:..:...|:::..|:
  Fly    39 RRGIVILGYACYLISISLMVIYEC----YANIVALQKDIHKFHAEDSSKVMGNTQKVLVVAMFVW 99

  Fly   100 GVTVISLQVFARRHLGIYQRLAALDARLMSDFGANLNYRKMLRKNIAVLGIVTTIYLMAINSAAV 164
            ....|.|..  ||...||..:|.|:..|.:.....:..|...|.... |.:...::::       
  Fly   100 NQLNILLNF--RRLARIYDDIADLEIDLNNASSGFVGQRHWWRFRFR-LALSVGLWIV------- 154

  Fly   165 QVASGHRALFLLFALC--YTIVTGGPHFTGYVHMT---LAEMLGIRFRL-------LQQLLQPEF 217
                      ||..|.  :|:|..||    |:|.|   |.|::.|..:|       ...|:....
  Fly   155 ----------LLVGLTPRFTLVALGP----YLHWTNKVLTEIILIMLQLKCTEYCVFVLLIYELI 205

  Fly   218 LNWR--FPQLHVQELRIRQVVSMIQELHYLIQE----INRVYAL----SLWAAMAHDLAMSTSEL 272
            |..|  ..|:.| ||...|....:|||...::.    ..|::.|    ||:..::..|....:||
  Fly   206 LRGRHILQQISV-ELEGNQSRDSVQELCVALKRNQLLAGRIWGLVNEVSLYFTLSLTLLFLYNEL 269

  Fly   273 YILFGQSVG---IGQQNEEENGSC-YRMLGYLALVMIPPLYKLLIAPFYCDRTIYEARR------ 327
            .||  |.|.   |...|..|  .| ||.:|...|:.|......|.:.| |.:|.....|      
  Fly   270 TIL--QIVNWALIKSVNPNE--CCQYRRVGTCLLLSINIFLSCLYSEF-CIQTYNSISRVLHQMY 329

  Fly   328 CLRLVEKLDDWFPQKSSLRPLVESLMSWRIQ---AKIQFTSGLDVVLSRKVIGLFTSILVNYLLI 389
            ||...|   |:...|..||       .:.:|   .|:.||.|....::.|..|.....|..|::|
  Fly   330 CLSAAE---DYLILKMGLR-------EYSLQMEHLKLIFTCGGLFDINLKFFGGMVVTLFGYIII 384

  Fly   390 LIQF 393
            |:||
  Fly   385 LVQF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 94/394 (24%)
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 94/394 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.