DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr32a

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster


Alignment Length:368 Identity:77/368 - (20%)
Similarity:142/368 - (38%) Gaps:95/368 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LELLMSTLVFGVTVISLQVFARRHLGIYQRLAALDARLMSDFGANL--NYRKMLR---------- 142
            :|||:..|.:.:||..........|.|...:..||..:...|||||  |:..:::          
  Fly   132 IELLLCILTYTLTVFVCAHNTTSMLRIMNEILQLDEEVRRQFGANLSQNFGFLVKFLVGITACQA 196

  Fly   143 -----KNIAVLGIVT-TIYLMAINSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTLAEM 201
                 |..||.|.:| |.|::.   |...:.:|..|.:::||                 ..|..:
  Fly   197 YIIVLKIYAVQGEITPTSYILL---AFYGIQNGLTATYIVFA-----------------SALLRI 241

  Fly   202 LGIRFRLLQQLLQPEFLNWRFPQLHVQE---LRIRQ-----------------------VVSMIQ 240
            :.|||..:.|||.    .:.:.|.|.::   .|.|:                       :..|..
  Fly   242 VYIRFHFINQLLN----GYTYGQQHRRKEGGARARRQRGDVNPNVNPALMEHFPEDSLFIYRMHN 302

  Fly   241 ELHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRML----GYLA 301
            :|..:.:.||....|.|.:.:.:.....|:..|.||.|..|.|..:......|:..|    ..||
  Fly   303 KLLRIYKGINDCCNLILVSFLGYSFYTVTTNCYNLFVQITGKGMVSPNILQWCFAWLCLHVSLLA 367

  Fly   302 LVMIPPLYKLLIAPFYCDRTIYEARRCLRLVEKLDDWFPQKSSLRPLVESLMSWRIQAKIQFTS- 365
            |:...           |..|..||....:::.::   :.:....:.:::..::..|:.::|||: 
  Fly   368 LLSRS-----------CGLTTTEANATSQILARV---YAKSKEYQNIIDKFLTKSIKQEVQFTAY 418

  Fly   366 GLDVVLSRKVIGLFTSILVNYLLILIQFAMTQKMGEQIEQQKI 408
            |...:.:..:..:|::: ..||:|||||       :|:|..|:
  Fly   419 GFFAIDNSTLFKIFSAV-TTYLVILIQF-------KQLEDSKV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 74/355 (21%)
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 75/362 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.