DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and egl-47

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001023728.1 Gene:egl-47 / 183687 WormBaseID:WBGene00001211 Length:522 Species:Caenorhabditis elegans


Alignment Length:350 Identity:64/350 - (18%)
Similarity:123/350 - (35%) Gaps:113/350 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RRSTFRISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDIRERLAKADNLVLSISALELLMSTLVF 99
            |.|.|..||.. ::.:|.::.:...||..|::..|..|.:.|..:....::.          |:.
 Worm    92 RESLFECSWRG-VHCVSNSLRSILFLFRLLAIFPATTDRKSRRKRNHRSIIK----------LIL 145

  Fly   100 GVTVISLQVFARRHLGIYQRLAALDARLMSDFGANLNYR-KMLRKNIAVLGIVTTIYLMAINSAA 163
            .|..|.|.|                  |::.|...:|:: .||.|:  ..|::.|..:.::.:|.
 Worm   146 YVNYIVLAV------------------LLNSFLIKMNFKVLMLYKH--KFGLMHTGTVASMITAT 190

  Fly   164 VQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQ 228
            ..|                           :::.:..:..|:|:..|:||:         .:.:.
 Worm   191 KPV---------------------------INVFVIVLSAIKFKSHQRLLK---------TIDMV 219

  Fly   229 ELRIRQVVSMIQELHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEE--NG 291
            ::..|....:...|        |:|....:..:   |.:..|.|.:...:.||.|:...|.  ..
 Worm   220 DVCFRSAFGVSPPL--------RIYKFVFFFTL---LIIFFSALILKVVEFVGTGEIFGEHILTD 273

  Fly   292 SCYRMLGYLALVMIPP-----LYKLLIAPFYCDRTI------------------YEA-RRCLRLV 332
            ..:.::..|:|..|.|     ||.:|:. ||| ||:                  ||. .|...:.
 Worm   274 CSFILVPVLSLWNIIPLLYYHLYNILVR-FYC-RTLIKSMNREHKKRHFSLKFYYEQFTRITNVQ 336

  Fly   333 EKLDDWFPQKSSLRPLVESLMSWRI 357
            |.:.|.|      .||:...::|.:
 Worm   337 EAVGDVF------NPLLLFSLAWSL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 64/349 (18%)
egl-47NP_001023728.1 7tm_7 110..495 CDD:303125 58/330 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.